CAZyme Information: MGYG000004902_01112

Basic Information

• Species: An23 sp900545755
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; An23; An23 sp900545755
• CAZyme ID: MGYG000004902_01112
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000004902_29|CGC1	41224.24	7.016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004902	2322562	MAG	Spain	Europe

• Gene Location: Start: 332; End: 1456 Strand: +

Full Sequence      

MSIFISSGEASGDHYTARLAVKLRERGYADDIWGMGGVESRNAGVRAEWNGERLQLLGLT
EVFSAIPSILALRREMVERIIERAPEAVVVCDSPDYHMRLIAKLRARGYSGKIFYLSPPT
VWAWRSGRADDLRRDVDECLPLFKFEHDYLLSRGCASAWKGHPLLEEYNHRVETQDLGVD
YDPGKLVAFLPGSRGSEIKSLLPIMEEAASALGAMGWQPVFSVAPGLNPAVRGEMIGRFA
EKGIRHYDGPGGALMEASECAVGASGTITVEALLRRRYMVVTYRLNPISAFVARRVIKTK
YYAMANILAGCEMFPELLQENATAANLTNAALAWLENRGGLRGRTGGVMERARATLGEEG
VYDFWCARITGEAA

Enzyme Prediction     

No EC number prediction in MGYG000004902_01112.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	338	2.9e-86	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	2.07e-80	1	320	2	327	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	4.56e-73	1	320	2	324	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.88e-71	3	320	1	324	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.41e-42	2	318	228	551	lipid-A-disaccharide synthase; Reviewed
PRK14089	PRK14089	1.59e-35	1	320	2	302	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ45970.1	9.19e-186	1	374	1	375
AER66289.1	5.92e-107	1	369	1	366
QTX31623.1	1.14e-90	1	369	1	366
QVL35430.1	3.23e-90	1	369	1	366
AFM20975.1	7.17e-85	1	365	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.21e-37	1	337	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.26e-37	1	337	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.15e-54	3	363	7	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	1.74e-53	3	360	11	369	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q6ALW0	7.26e-53	3	328	12	343	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B8JE78	1.33e-52	3	360	11	369	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.87e-52	3	360	11	369	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997902	0.001898	0.000164	0.000011	0.000006	0.000035

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004902_01112.