CAZyme Information: MGYG000004903_00554

Basic Information

• Species: Blautia sp900555025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900555025
• CAZyme ID: MGYG000004903_00554
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		59754.66	4.6259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004903	2530621	MAG	China	Asia

• Gene Location: Start: 46107; End: 47648 Strand: +

Full Sequence      

MKKFIRTLGIGVLASAFFWTVPVYAETETAGSSLKEEQMSEKAIELYSEEKEKLTGEWKQ
NKEGWWYYEYSNGTSPKISWRKIDGKWYYFNSKGYWIDDNTYEEGTLKGIDVSAWQAEVD
WEAVKNDGIEFAMIRLGYNTNNLDKYYQRNMKEAEKVQIPVGVYYYSKATNEEEAVRDAE
FVIENLKGYKVSYPVAIDLEDKAQENLSKEEVGKIAKAFVDEVASAGYTPMVYANEYWHE
NHIDWSLLEGVEKWIASYAVIPNRNIERGIWQCCDTGLVDGVDGNTDINFGNKDYTKEIE
ARTEPLESYYKRGLWMKNDRGWWYQYKKGGYPYNQWESINGKWYWFDKEGYVVTGWQFID
GYWYYLDESGAMTTGWQSIDGYWYYLKSSGVMAIGWESIGGAWYHMDNSGVMQTGWQQLN
GNWYYLKPSGVMAIGWERVGGAWYHMDSLGIMQTGWQSISGSWYYMNKSGAMQTGWLYLD
GNWYYLKSSGAMVTGRHYIDGKWYSFSSSGVMQ

Enzyme Prediction     

No EC number prediction in MGYG000004903_00554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	110	282	4.7e-45	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.92e-68	108	290	2	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	4.30e-61	332	513	441	622	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	9.71e-60	317	512	446	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.12e-56	332	512	484	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	5.98e-51	317	492	489	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68843.1	8.64e-194	8	340	1	334
ACR76367.1	2.29e-59	8	296	15	352
QCU01355.1	8.25e-49	72	329	54	330
AWY97591.1	4.49e-47	43	290	27	283
ACU94532.1	1.08e-42	103	341	181	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	7.37e-18	78	289	244	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
4KRU_A	1.36e-17	107	299	20	211	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WWC_A	1.75e-17	78	289	244	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRT_A	8.04e-17	107	299	20	211	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WAG_A	3.76e-15	107	294	16	211	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	7.50e-15	107	309	9	220	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	1.60e-13	107	289	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
Q8X7H0	5.22e-13	106	307	66	269	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	7.03e-13	106	307	66	269	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	4.20e-12	106	292	66	255	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000500	0.998605	0.000217	0.000240	0.000214	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004903_00554.