CAZyme Information: MGYG000004903_00745

Basic Information

• Species: Blautia sp900555025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900555025
• CAZyme ID: MGYG000004903_00745
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1128	MGYG000004903_14|CGC1	125595.64	4.1432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004903	2530621	MAG	China	Asia

• Gene Location: Start: 14825; End: 18211 Strand: +

Full Sequence      

MGKKKKSKKAIAGISAFVLGASALVPAFPVYGAEGISVNPQIHYQTLKGWGTSLCWWGNT
IGSWGEQDFNGNGRPDREEIAELAFSPEYLNLNIVRYNVGGGDKENTSIKRCEGLVPGWT
EDMTGTKDGTGEFNAEEFYSKSTEEMADAGQLWMLEQANKWRQEEGDIINEVFSNSPPYY
MTKSGSSTGGYNWDKNNLKDDQYDEFAQYLARATKWVDQDLEKKYGTGVSYVEPLNEPDT
NYWMDGSTKQEGCIFNTGELQSKAYREMQKALETEGLTDIQITGTDETSLWSANNSFNRL
DNDVKENMTTIGAHTYSGNNAERNELRQTAQKYDKDLWMSEVTKGGGAHEDGCHESMDAA
NTRSQSEGIMADLKYMQPTAWIAWLIADSEYECLQTNSNWGLLHAVFEKDGPVPDYHTNL
VNSDGSKKDWVPEEGYWAITKQFYTMMQYSKYLKTGYTMIDVGDGNMCAAISPTGDELVV
VAQNFGNERNVSVDLSKFSGNMEAEIYRTSDSESCEKIETQDVSDTTLEMTLPTDSVSTA
VVRATDGAPICDVDNYSKIVDADVEKPDEEWTKAENKFTYDGLWRNSAEEYGGGKYSTEE
NAGVTFTFEGDQAAIYGTKVPEGAVVNVVVDGEDKGQIELTAEEKDGEVMLFDTGKLKQG
THTVTFTKADGEGDKLIEINYGRIISGEFIEDILRVETLEDIYTIAGQKPEFPKIVQVMT
NKGTTTEKTVEWNLKDIDFTQDVTVHGKIEGTNKTVPVNVKVIAANIEYFVDCNSPKSPL
YEKIDSLSELKNDTPDQAYKEGSWGYKEQYGEYNGDINDHYDTGWYAYGGQSIEYTFPLE
AGTYNVDFGFKEWWKDGNKSRPMAISMTVNGETTELGKTNTWNGGSWWNKASYQITCEEA
ADVTFTIAKAENNDPVLSFIQIQKEEKAEEISRLDILIEKAKELLNNEDVYTLSSAQALK
DALTQAELLDQSQASEQELAAAYNELAAAMTGLVRTANKSELENAVNRAKQILADKNLYV
EDTLENLSDTLQKAEEILADKEAAKESVEEILKKLINEILEVRLMGDVDMNGKVDTADAA
VVLRSSAELNTMTAEQENIADVNRDGSCSLDDAVCILQYASEKIESFQ

Enzyme Prediction     

No EC number prediction in MGYG000004903_00745.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	36	539	4.3e-131	0.9956140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.20e-24	36	385	4	354	O-Glycosyl hydrolase family 30.
cd14256	Dockerin_I	2.50e-09	1066	1119	2	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd14253	Dockerin	7.74e-07	1066	1120	1	55	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
pfam17996	CE2_N	1.21e-04	601	692	19	99	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam00404	Dockerin_1	4.44e-04	1066	1107	1	42	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99102.1	0.0	1	1127	1	1359
QIB57138.1	0.0	1	1127	1	1347
QMW80085.1	0.0	1	1127	1	1347
ADL05173.1	1.06e-277	36	924	44	1192
ASU27677.1	6.45e-121	109	978	302	1029

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A401ETL2	1.28e-30	15	517	14	589	Exo-beta-1,6-galactobiohydrolase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=bl1,6Gal PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000478	0.998762	0.000207	0.000217	0.000174	0.000149

TMHMM  Annotations     

start	end
11	33