CAZyme Information: MGYG000004903_00976

Basic Information

• Species: Blautia sp900555025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp900555025
• CAZyme ID: MGYG000004903_00976
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843		94841.69	4.6844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004903	2530621	MAG	China	Asia

• Gene Location: Start: 6006; End: 8537 Strand: +

Full Sequence      

MKNRLSRWIAAMTAGTMITCPIVGNLNIVNAADGNQVLIENELNYIYIDESETEVGNTQN
IVVSWGENKSEIKSINLVVEDEKGSQTILNSEKRVDELFLYEHSFEKGIYHVKEVSVATD
ADVKTFTAEELDIDAYFGVDEKVNEDVKSDYIEMESQFTEEAVVTIETNHISTIEKSVAD
ALSEQAEPFSRSKRDVRDSNLVIVLDPGHDASIHAGASANGVREEIVTLKIAEYCKKVLE
QYAGVSVYMTRTDGNCPFPGTNSIDDILKRVEWAKTKDADAFISFHINSSDSSAAHGAEV
YYPKGEEGAQNLAKDIVEELAKLGIKSRGEKSDESYAVIRHSKRNGFPGLIIEHAFVSNA
SDAKWFQTEENLRKLGEADAAGIINYYGLKKGEWEFTDGYWKWKEGLGRYATSTWKLINN
VWYYFDANSNMTTGWQAIGGNWYYMDKSGAMQTGWQAVDGNWYYMNDSGAMQTGWQAVDG
HWYYMNISGVMQTGWQLVDGNWYYMNNSGAMQTGWQFVDGHWYYMNISGVMQTGFQNVGK
EKCYFDKNGVMQTGWQFIDNAWYYFNNSGYLLKGEQTIAGEKWYLDEKTGAWYTGWQDIA
GKRYYYDSYGKKMTGWQDIAGKKYYMDKDGVVQTGWKNIDNIWYYFESTGELNSNPSSKP
PTNDTVVSRYEIAGNSSVTVAQMVNYYKKSGKAYPAEALKVGGAATIEEFCQIYYEECKT
EGIKAEVAFVQAMIETGFLQFGGSVKIEQFNFAGLGASGNGASGNSFENVRIGIRAHVQH
LKCYANTEPLKNECVDPRWGEWLRGKAPYVEWLSIPNNPYGTGWAGDVNYAAKILSGIQG
LKK

Enzyme Prediction     

No EC number prediction in MGYG000004903_00976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	711	839	3.2e-17	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.25e-54	391	591	442	641	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	4.92e-51	415	591	488	664	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	2.63e-48	391	571	485	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	7.85e-47	450	655	440	624	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
cd02696	MurNAc-LAA	1.91e-46	202	384	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM68313.1	1.98e-299	1	843	1	1051
QHB24702.1	9.49e-61	653	842	68	258
QEI32209.1	9.49e-61	653	842	68	258
QRT30849.1	9.49e-61	653	842	68	258
CBL26238.1	1.96e-58	666	842	78	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EMI_A	1.94e-14	201	386	5	177	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
7RAG_B	3.09e-14	199	391	15	213	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]
5J72_A	1.44e-13	156	383	408	633	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
1JWQ_A	8.71e-12	202	390	3	179	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
4BIN_A	3.40e-10	197	387	170	393	Crystalstructure of the E. coli N-acetylmuramoyl-L-alanine amidase AmiC [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.01e-21	707	834	68	188	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
Q02114	2.18e-16	203	387	322	495	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q9RMZ0	7.31e-15	203	390	335	523	Uncharacterized cell wall amidase pXO2-42/BXB0045/GBAA_pXO2_0045 OS=Bacillus anthracis OX=1392 GN=pXO2-42 PE=3 SV=2
O48471	1.57e-14	202	391	4	185	Endolysin OS=Bacillus phage SPP1 OX=10724 GN=25 PE=4 SV=1
Q4L6X7	9.35e-14	200	387	119	289	Probable cell wall amidase LytH OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=lytH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000414	0.998756	0.000308	0.000189	0.000161	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004903_00976.