CAZyme Information: MGYG000004905_00149

Basic Information

• Species: UBA7488 sp002477185
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; UBA3637; UBA7488; UBA7488 sp002477185
• CAZyme ID: MGYG000004905_00149
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000004905_22|CGC1	39741.23	9.7495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004905	1280084	MAG	Spain	Europe

• Gene Location: Start: 2995; End: 4104 Strand: +

Full Sequence      

MNEKQHKKPLAIVTTGGSGGHIFPAEAISQALIGKGFDVVFVTDKRGKAFQGLKGVKVYN
LMAEHVMGRSFFGKMAGAFKLYCGAIQALFLLKKLKPAVVVGVGGYASLPAVLAAHLWHI
PVVLHEQNAVLGRANRVLAHNTRLIALSFEPTLRVPNDIRTVLVGMPARPAVLEHANAPY
PLTDNGFHLLIFGGSQGASFFSKRLPEAFKLLPAEVAAKMHVTAQVRAEDMEKAQELYAQ
IPFKSVTLKSFFDNMPELIEQAHLIIGRAGASTITEAAIIGRPAILIPLPSAADNHQMEN
AKRFSDAGAGWLMSEGNYDPEKFAARLAQMVNEPEILYQAGTQAHNIALPDAAEKMADVV
ADIAKGSAR

Enzyme Prediction     

No EC number prediction in MGYG000004905_00149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	352	1e-41	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.81e-118	12	366	5	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	9.99e-110	12	359	3	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	5.57e-99	12	366	4	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.80e-87	12	360	4	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	9.58e-37	188	354	1	164	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDK99712.1	6.03e-97	8	364	3	363
AVM80177.1	1.71e-96	8	364	3	363
AVM76274.1	1.71e-96	8	364	3	363
ASG21121.1	1.25e-94	12	366	5	358
CCG09286.1	1.33e-94	12	367	15	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.23e-55	8	366	2	357	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	7.96e-52	1	360	1	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	4.02e-35	12	365	10	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2RVU4	1.73e-90	9	360	16	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=murG PE=3 SV=1
Q2W0H3	2.39e-89	7	360	4	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=murG PE=3 SV=1
B6IRG2	6.11e-89	12	360	7	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=murG PE=3 SV=1
B0UFC7	3.18e-84	8	364	5	366	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylobacterium sp. (strain 4-46) OX=426117 GN=murG PE=3 SV=1
Q0BV25	1.62e-81	1	360	1	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004905_00149.