y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.012G185000.1
FamilyGT1
Protein PropertiesLength: 478 Molecular Weight: 52316.1 Isoelectric Point: 6.7582
ChromosomeChromosome/Scaffold: 12 Start: 35217031 End: 35219089
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12564485.2e-32
  SDRGNSGSSSDLNDQVMTWLNQCPDGSVVYVCFGSQKLLRKEQMEALASGLEKSDTRFIWVVKPGTTQQHVEGFGVVPDGFEQRTAGQGLVIKGWAPQAL
  ILNHKAVGGFLSHCGWNSVSEAIVGGVMMLAWPMEADQFVNARLLVDDMGVGVRVCEGADSVPNSDELGRVISEAMTEGGGMKTKAKDLKDKA
Full Sequence
Protein Sequence     Length: 478     Download
MATAATRSNP HPHILVFPYP AQGHMLALLD LTHQLALHGL TITILVTPKN LPFLSPLLSS    60
HPSSITPLVF PFPSHPLIPP GVEHVKDVGN CGNRLIMAAL GKLEDPLFNW FNSQSNPPVA    120
IISDFFLGWT QHLATRLQIP RLAFFSTRAF LVSVFDYIWN NVEKVKCLSE VEFGHLPGSP    180
VFKQEHLPSL FKLYKRSDPD WEFVKDGLLA NTKSWGYVLN SFDALEGEYV QWLKTHVAHD    240
RVFNVGPLSL IGPDVSDRGN SGSSSDLNDQ VMTWLNQCPD GSVVYVCFGS QKLLRKEQME    300
ALASGLEKSD TRFIWVVKPG TTQQHVEGFG VVPDGFEQRT AGQGLVIKGW APQALILNHK    360
AVGGFLSHCG WNSVSEAIVG GVMMLAWPME ADQFVNARLL VDDMGVGVRV CEGADSVPNS    420
DELGRVISEA MTEGGGMKTK AKDLKDKAFA AVSHGGSSMN DLVRFVKELG QLGSIRR*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02448PLN024483.0e-492472494+
PLN03004PLN030041.0e-56120433319+
PLN03007PLN030073.0e-6613469486+
PLN02534PLN025341.0e-6812410419+
PLN02863PLN028631.0e-16013473468+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD89044.10134749466putative glycosyltransferase [Solanum aculeatissimum]
RefSeqXP_002268341.101347110462PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268383.101347210463PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002314912.101247211469predicted protein [Populus trichocarpa]
RefSeqXP_002514575.1024718472UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A0124627460I Chain I, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated St
PDB2vch_A0124627460I Chain I, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated St
PDB2vce_A0124627460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A084695477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acw_B3e-3794697461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT4686322581303860
CO1211362422324730
CO09661224012400
EG631256483124720
FS945677289693570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G184900.1Gorai.008G174800.1Gorai.012G185100.1
Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)