| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_9313068g0010 |
| Family | GH17 |
| Protein Properties | Length: 129 Molecular Weight: 13537.5 Isoelectric Point: 4.1093 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 31 | 126 | 1.2e-39 |
| VGICYGRVADNLPAPADVVSLLKANNIGKVRLFDSDPAVLQAFSGSGIGLVTAVPNEDLQSIGSNPEAAAEWVQGNVVPFYPATRIEYIAVGNEVL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 129 Download |
| MASFQLRFCT LQAFAFCIIV LCSSSADAGT VGICYGRVAD NLPAPADVVS LLKANNIGKV 60 RLFDSDPAVL QAFSGSGIGL VTAVPNEDLQ SIGSNPEAAA EWVQGNVVPF YPATRIEYIA 120 VGNEVLLNN |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-36 | 31 | 125 | 95 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAB80165.1 | 4e-30 | 16 | 129 | 9 | 124 | putative protein (fragment) [Arabidopsis thaliana] |
| GenBank | EEC82195.1 | 5e-31 | 14 | 126 | 12 | 124 | hypothetical protein OsI_26335 [Oryza sativa Indica Group] |
| RefSeq | NP_001059878.1 | 5e-31 | 14 | 126 | 12 | 124 | Os07g0538000 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002338479.1 | 1e-31 | 14 | 128 | 5 | 120 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525370.1 | 7e-31 | 5 | 129 | 6 | 134 | Glucan endo-1,3-beta-glucosidase, acidic isoform precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 2e-28 | 31 | 126 | 1 | 96 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 3e-25 | 31 | 125 | 2 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 3e-25 | 31 | 125 | 2 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 3e-25 | 31 | 125 | 2 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 3e-25 | 31 | 125 | 2 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 0 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EX307121 | 129 | 1 | 129 | 0 |
| GE475728 | 129 | 1 | 129 | 0 |
| DV995244 | 129 | 1 | 129 | 0 |
| ES245935 | 129 | 1 | 129 | 0 |
| CO475514 | 128 | 2 | 129 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |