y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g042447m
FamilyGH28
Protein PropertiesLength: 356 Molecular Weight: 38210.1 Isoelectric Point: 4.9836
ChromosomeChromosome/Scaffold: 00003 Start: 1714675 End: 1717889
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28652610
  NTACSTPKSVFLVPAGRHYLVSATRFKGPCADKLVIQIDGTIVAPAEPDNWDPKLARIWLDFSKLNGVLFQGSGVIDGSGSKWWASSCKKNKSESVRVYQ
  VLVSAPEDSPNTDGIHITESTNVVLQDCKIGTGDDCISIVNGSSAIKMKRIFCGPGHGISIGSLGKDNSMGIVTKVVLDTAYLRETANGLRIKTWQT
Full Sequence
Protein Sequence     Length: 356     Download
MVHDNIALLG ELENLNVEEE NEVELFEEPS WTSERGGKVL VNVDSFGAAG DGVSDDTQAF    60
LNAWNTACST PKSVFLVPAG RHYLVSATRF KGPCADKLVI QIDGTIVAPA EPDNWDPKLA    120
RIWLDFSKLN GVLFQGSGVI DGSGSKWWAS SCKKNKSESV RVYQVLVSAP EDSPNTDGIH    180
ITESTNVVLQ DCKIGTGDDC ISIVNGSSAI KMKRIFCGPG HGISIGSLGK DNSMGIVTKV    240
VLDTAYLRET ANGLRIKTWQ TSAVKISQIM YRNISGTTKS SKAMKFACSD TVPCSDIVLS    300
NVNLEKKDGT VETYCNSAQG IGYGIVHPSA DCLTSNDKDA KLAEPTRNEI VHTEL*        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02188PLN021881.0e-5940309348+
PLN03010PLN030103.0e-6242309332+
PLN03003PLN030031.0e-6441333369+
PLN02218PLN022182.0e-7041328367+
PLN02793PLN027934.0e-9529336387+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI28554.1023556731111unnamed protein product [Vitis vinifera]
RefSeqNP_173760.20135325455polygalacturonase [Arabidopsis thaliana]
RefSeqXP_002299032.10135523469predicted protein [Populus trichocarpa]
RefSeqXP_002317091.1083551447predicted protein [Populus trichocarpa]
RefSeqXP_002328587.10134423444predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1rmg_A0.00000000000083332313358A Chain A, Rhamnogalacturonase A From Aspergillus Aculeatus
PDB1nhc_F0.000000000027731228293A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_E0.000000000027731228293A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_D0.000000000027731228293A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_C0.000000000027731228293A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE686036251292410
EV550328222772600
CA929934207922600
EV271942218542330
EY71841921211740
Orthologous Group
SpeciesID
Brachypodium distachyonBradi1g04640.1.50.217Bradi1g04640.1.50.217
Citrus sinensisorange1.1g039868m.44.127orange1.1g039868m.44.127
Picea abiesMA_10862g0010MA_10426591g0010
Selaginella moellendorffii102892113633.59.225113633.59.225
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny