Basic Information | |
---|---|
Species | Brachypodium distachyon |
Cazyme ID | Bradi1g65820.2 |
Family | AA2 |
Protein Properties | Length: 251 Molecular Weight: 27496.2 Isoelectric Point: 5.9237 |
Chromosome | Chromosome/Scaffold: 1 Start: 64743407 End: 64746572 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 21 | 246 | 0 |
RKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKKPAEQAHAANAGLDIAVRMLEPIKEEIPTISYADLYQLAGVVAVEVSGGPEIPFHPGRE DKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTREPLKFDNTYFTELLSGDKEGLLQLPSDKTLLSDPVFRPL VEKYAADEKAFFEDYKEAHLRLSELG |
Full Sequence |
---|
Protein Sequence Length: 251 Download |
MAKTYPTVSA EYQEAVEKAR RKLRALIAEK SCAPLMLRLA WHSAGTFDVS SKTGGPFGTM 60 KKPAEQAHAA NAGLDIAVRM LEPIKEEIPT ISYADLYQLA GVVAVEVSGG PEIPFHPGRE 120 DKPQPPPEGR LPDATKGSDH LRQVFGKQMG LSDQDIVALS GGHTLGRCHK ERSGFEGPWT 180 REPLKFDNTY FTELLSGDKE GLLQLPSDKT LLSDPVFRPL VEKYAADEKA FFEDYKEAHL 240 RLSELGYAEA * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 6.0e-59 | 17 | 244 | 256 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02879 | PLN02879 | 3.0e-137 | 3 | 249 | 247 | + L-ascorbate peroxidase | ||
PLN02608 | PLN02608 | 8.0e-139 | 6 | 247 | 242 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 1.0e-144 | 1 | 250 | 250 | + L-ascorbate peroxidase 1 | ||
cd00691 | ascorbate_peroxidase | 2.0e-147 | 5 | 246 | 250 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAA06996.1 | 0 | 1 | 250 | 1 | 250 | ascorbate peroxidase [Hordeum vulgare subsp. vulgare] |
RefSeq | NP_001150192.1 | 0 | 1 | 250 | 1 | 250 | APx1 - Cytosolic Ascorbate Peroxidase [Zea mays] |
RefSeq | NP_001152249.1 | 0 | 1 | 250 | 1 | 250 | APx1 - Cytosolic Ascorbate Peroxidase [Zea mays] |
RefSeq | NP_001152746.1 | 0 | 1 | 250 | 1 | 250 | ascorbate peroxidase [Zea mays] |
RefSeq | XP_002468053.1 | 0 | 1 | 250 | 1 | 250 | hypothetical protein SORBIDRAFT_01g038760 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2xj6_A | 0 | 3 | 250 | 2 | 249 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2xih_A | 0 | 3 | 250 | 2 | 249 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2xif_A | 0 | 3 | 250 | 2 | 249 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0 | 3 | 250 | 2 | 249 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2ghk_X | 0 | 3 | 250 | 14 | 261 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DV472218 | 251 | 1 | 251 | 0 |
DV482821 | 251 | 1 | 251 | 0 |
DV471134 | 251 | 1 | 251 | 0 |
DV471218 | 251 | 1 | 251 | 0 |
DV471319 | 251 | 1 | 251 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|