Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.016G084800.4 |
Family | AA2 |
Protein Properties | Length: 238 Molecular Weight: 26204.9 Isoelectric Point: 6.8543 |
Chromosome | Chromosome/Scaffold: 16 Start: 6654567 End: 6658024 |
Description | ascorbate peroxidase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 25 | 224 | 0 |
GLIAEKHCAPLMLRLAWHSAGTFDVNTKTGGPFGTIRHPDELAHGANNGLDIAVRLLEPLKEQFPNLSYADFYQLAGVVAVEITGGPEVPFHPGRPDKSD PPPEGRLPDATKGSDHLRDVFGHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTPNPLVFDNSYFKELLSGEKEGLIQLPTDKTLLEDPVFRPLVEKYA |
Full Sequence |
---|
Protein Sequence Length: 238 Download |
MGKCYPTVSE EYQKAVEKCK RKLRGLIAEK HCAPLMLRLA WHSAGTFDVN TKTGGPFGTI 60 RHPDELAHGA NNGLDIAVRL LEPLKEQFPN LSYADFYQLA GVVAVEITGG PEVPFHPGRP 120 DKSDPPPEGR LPDATKGSDH LRDVFGHMGL SDKDIVALSG GHTLGRCHKE RSGFEGPWTP 180 NPLVFDNSYF KELLSGEKEG LIQLPTDKTL LEDPVFRPLV EKYAAVSRHS FLFYISL* 240 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 6.0e-59 | 20 | 226 | 235 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 2.0e-131 | 6 | 224 | 219 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 2.0e-133 | 1 | 225 | 226 | + L-ascorbate peroxidase 1 | ||
cd00691 | ascorbate_peroxidase | 5.0e-141 | 5 | 225 | 229 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02879 | PLN02879 | 3.0e-141 | 1 | 225 | 225 | + L-ascorbate peroxidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABB46514.2 | 0 | 3 | 234 | 4 | 235 | putative ascorbate peroxidase [Litchi chinensis] |
GenBank | ABS50864.1 | 0 | 3 | 234 | 4 | 235 | cytosolic ascorbate peroxidase [Dimocarpus longan] |
GenBank | ACM17463.1 | 0 | 1 | 234 | 1 | 234 | ascorbate peroxidase [Citrus maxima] |
RefSeq | XP_002322851.1 | 0 | 1 | 234 | 1 | 234 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002326165.1 | 0 | 1 | 224 | 1 | 224 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2xj6_A | 0 | 2 | 234 | 1 | 234 | A Chain A, Ascorbate Peroxidase R38k Mutant |
PDB | 2xih_A | 0 | 2 | 234 | 1 | 234 | A Chain A, Ascorbate Peroxidase R38k Mutant |
PDB | 2xif_A | 0 | 2 | 234 | 1 | 234 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0 | 2 | 234 | 1 | 234 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2y6b_A | 0 | 2 | 234 | 1 | 234 | A Chain A, Ascorbate Peroxidase R38k Mutant |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN520204 | 234 | 1 | 234 | 0 |
BU868645 | 234 | 1 | 234 | 0 |
DV466219 | 234 | 1 | 234 | 0 |
CN520473 | 234 | 1 | 234 | 0 |
DY800810 | 224 | 1 | 224 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|