Basic Information | |
---|---|
Species | Medicago truncatula |
Cazyme ID | Medtr5g008440.1 |
Family | AA2 |
Protein Properties | Length: 199 Molecular Weight: 22355.1 Isoelectric Point: 4.1014 |
Chromosome | Chromosome/Scaffold: 5 Start: 1542804 End: 1543891 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 29 | 106 | 2.1e-21 |
ILEPLKEQFLIISYVDFYQLSGVVAVEITGGPEVPFHPGGEDKPEPPLEGRLPDATEGSNHLRDVFGKSMGLSDQDIV |
Full Sequence |
---|
Protein Sequence Length: 199 Download |
MQTQTPALVE LIETSRNVWL IFHWKSKVIL EPLKEQFLII SYVDFYQLSG VVAVEITGGP 60 EVPFHPGGED KPEPPLEGRL PDATEGSNHL RDVFGKSMGL SDQDIVRSGF EGPWTSNPLI 120 FDNSYFTKLL GGEKEGLLQL PSDKALLSDL VFRLLVEKYV ADEDAFFADY VEARQKLFEL 180 GDEEDFRLED ESSPTWGE* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 1.0e-24 | 29 | 177 | 189 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 2.0e-62 | 29 | 181 | 167 | + L-ascorbate peroxidase | ||
PLN02879 | PLN02879 | 3.0e-64 | 29 | 181 | 167 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 1.0e-70 | 29 | 181 | 174 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02364 | PLN02364 | 2.0e-71 | 29 | 181 | 167 | + L-ascorbate peroxidase 1 |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2GGN | 0 | 29 | 181 | 91 | 257 | X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase |
GenBank | AAA61779.1 | 0 | 29 | 181 | 80 | 246 | ascorbate peroxidase [Glycine max] |
GenBank | ACJ84589.1 | 0 | 29 | 181 | 80 | 246 | unknown [Medicago truncatula] |
DDBJ | BAA76419.1 | 0 | 29 | 181 | 7 | 173 | ascorbate peroxidase [Cicer arietinum] |
DDBJ | BAC92738.1 | 0 | 29 | 181 | 80 | 246 | cytosolic ascorbate peroxidase 1 [Glycine max] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zch_A | 0 | 29 | 181 | 91 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 3zcy_A | 0 | 29 | 181 | 79 | 245 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 3zcg_A | 0 | 29 | 181 | 91 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2wd4_A | 0 | 29 | 181 | 91 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2vo2_X | 0 | 29 | 181 | 91 | 257 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BG644452 | 197 | 2 | 181 | 0 |
CB892649 | 167 | 29 | 181 | 0 |
CB892269 | 173 | 29 | 187 | 0 |
BG580667 | 167 | 29 | 181 | 0 |
CB892934 | 167 | 29 | 181 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|