Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_018316m |
Family | AA2 |
Protein Properties | Length: 153 Molecular Weight: 16642 Isoelectric Point: 5.7844 |
Chromosome | Chromosome/Scaffold: 00847 Start: 1395823 End: 1397579 |
Description | ascorbate peroxidase 6 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 1 | 146 | 2.3e-36 |
MIAVAGAEAVSICGGPTIPVILGRRDSVEPDAEGRLPEESLGASALKQCFKRKGLSTQVLVALSGAHTLGSKGFGNPFVFDNSYYKILLEKPWNSSDKMA SMIGLPSDHALVEDDECLRWIKKYADDQDIFFEDFKNAYIKLVNSG |
Full Sequence |
---|
Protein Sequence Length: 153 Download |
MIAVAGAEAV SICGGPTIPV ILGRRDSVEP DAEGRLPEES LGASALKQCF KRKGLSTQVL 60 VALSGAHTLG SKGFGNPFVF DNSYYKILLE KPWNSSDKMA SMIGLPSDHA LVEDDECLRW 120 IKKYADDQDI FFEDFKNAYI KLVNSGARWK SL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00693 | secretory_peroxidase | 3.0e-29 | 2 | 144 | 192 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
PLN02608 | PLN02608 | 3.0e-33 | 4 | 142 | 149 | + L-ascorbate peroxidase | ||
PLN02879 | PLN02879 | 6.0e-34 | 4 | 146 | 153 | + L-ascorbate peroxidase | ||
cd00314 | plant_peroxidase_like | 9.0e-41 | 1 | 144 | 171 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
cd00691 | ascorbate_peroxidase | 1.0e-47 | 2 | 149 | 161 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU18323.1 | 0 | 1 | 152 | 168 | 319 | unknown [Glycine max] |
RefSeq | NP_194958.2 | 0 | 1 | 152 | 178 | 329 | APX6; L-ascorbate peroxidase/ heme binding / peroxidase [Arabidopsis thaliana] |
RefSeq | XP_002282677.1 | 0 | 1 | 152 | 179 | 330 | PREDICTED: similar to APX6 (ASCORBATE PEROXIDASE 6); L-ascorbate peroxidase [Vitis vinifera] |
RefSeq | XP_002309628.1 | 0 | 1 | 152 | 186 | 337 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002515511.1 | 0 | 1 | 152 | 177 | 328 | L-ascorbate peroxidase 1, cytosolic, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 3e-29 | 4 | 146 | 98 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 3e-29 | 4 | 146 | 98 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 3e-29 | 4 | 146 | 98 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 3e-29 | 4 | 146 | 98 | 245 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 3zcy_A | 1e-27 | 4 | 146 | 98 | 245 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DV446698 | 153 | 1 | 153 | 0 |
EC926353 | 150 | 1 | 150 | 0 |
FD537308 | 154 | 1 | 153 | 0 |
HO108432 | 153 | 1 | 153 | 0 |
CO115624 | 153 | 1 | 153 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|