Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01016658001 |
Family | GT68 |
Protein Properties | Length: 172 Molecular Weight: 19016.7 Isoelectric Point: 6.4991 |
Chromosome | Chromosome/Scaffold: 9 Start: 178485 End: 182939 |
Description | O-fucosyltransferase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT68 | 2 | 148 | 0 |
LTAQRFVQTFLGKSFTALHFRRHGFLKFCNAKEPSCFFPIPQAADCISRVVERADTPVIYLSTDAAESETGLLQSLVVLNGKLVPLIKRPTRNSAEKWDA LLYRHGLDGDSQVEAMLDKTICAMASVFIGAPGSTFTEDILRLRRGW |
Full Sequence |
---|
Protein Sequence Length: 172 Download |
MLTAQRFVQT FLGKSFTALH FRRHGFLKFC NAKEPSCFFP IPQAADCISR VVERADTPVI 60 YLSTDAAESE TGLLQSLVVL NGKLVPLIKR PTRNSAEKWD ALLYRHGLDG DSQVEAMLDK 120 TICAMASVFI GAPGSTFTED ILRLRRGWGS ASHCDEYLCQ GEQPNFIADN E* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd11548 | NodZ_like | 0.009 | 6 | 147 | 145 | + Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. | ||
cd11298 | O-FucT-2 | 4.0e-9 | 12 | 138 | 127 | + GDP-fucose protein O-fucosyltransferase 2. O-FucT-2 adds O-fucose to thrombospondin type 1 repeats (TSRs), and appears conserved in bilateria. The O-fucosylation of TSRs appears to play a role in regulating secretion of metalloproteases of the ADAMTS superfamily. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. | ||
cd11296 | O-FucT_like | 5.0e-17 | 4 | 146 | 153 | + GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ85563.1 | 0 | 1 | 171 | 72 | 242 | unknown [Medicago truncatula] |
EMBL | CAE30293.1 | 0 | 1 | 171 | 167 | 337 | GDP-fucose protein-O-fucosyltransferase 2 [Solanum tuberosum] |
EMBL | CAN80219.1 | 0 | 1 | 171 | 167 | 337 | hypothetical protein [Vitis vinifera] |
EMBL | CBI35787.1 | 0 | 1 | 171 | 1 | 171 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002264087.1 | 0 | 1 | 171 | 389 | 559 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4ap5_B | 0.005 | 12 | 138 | 263 | 369 | A Chain A, Crystal Structure Of Human Pofut2 |
PDB | 4ap5_A | 0.005 | 12 | 138 | 263 | 369 | A Chain A, Crystal Structure Of Human Pofut2 |
PDB | 4ap6_D | 0.005 | 12 | 138 | 277 | 383 | A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose |
PDB | 4ap6_C | 0.005 | 12 | 138 | 277 | 383 | A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose |
PDB | 4ap6_B | 0.005 | 12 | 138 | 277 | 383 | A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE062730 | 172 | 1 | 172 | 0 |
EE071099 | 172 | 1 | 172 | 0 |
FC054861 | 158 | 1 | 158 | 0 |
HO799664 | 171 | 2 | 172 | 0 |
FN718303 | 168 | 5 | 172 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|