Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a016109m |
Family | GH28 |
Protein Properties | Length: 135 Molecular Weight: 14417.7 Isoelectric Point: 9.6013 |
Chromosome | Chromosome/Scaffold: 721 Start: 31609 End: 32381 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 6 | 122 | 7e-35 |
LIVKNSTLIGTTNGIRIKTYPASGPSRAAGMLFKNIIMQNVKNPIIIDQNYGSDSTKPSLVRISDVIYDNIRGTTISPVAVNIVCSSQVPCQNVHLQNIN LQLNGNQKTTSTCANVK |
Full Sequence |
---|
Protein Sequence Length: 135 Download |
MDVLGLIVKN STLIGTTNGI RIKTYPASGP SRAAGMLFKN IIMQNVKNPI IIDQNYGSDS 60 TKPSLVRISD VIYDNIRGTT ISPVAVNIVC SSQVPCQNVH LQNINLQLNG NQKTTSTCAN 120 VKLGYTGLQF PPPC* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02155 | PLN02155 | 8.0e-17 | 3 | 134 | 136 | + polygalacturonase | ||
PLN02793 | PLN02793 | 4.0e-20 | 3 | 134 | 137 | + Probable polygalacturonase | ||
PLN02218 | PLN02218 | 3.0e-20 | 3 | 122 | 123 | + polygalacturonase ADPG | ||
pfam00295 | Glyco_hydro_28 | 6.0e-26 | 2 | 124 | 126 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
PLN02188 | PLN02188 | 6.0e-40 | 2 | 134 | 139 | + polygalacturonase/glycoside hydrolase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004650 | polygalacturonase activity |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN69218.1 | 8.00001e-41 | 2 | 129 | 287 | 421 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272193.1 | 0 | 2 | 134 | 287 | 426 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002314372.1 | 3.9937e-43 | 2 | 134 | 275 | 409 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002315493.1 | 1.99993e-41 | 2 | 134 | 240 | 374 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002334010.1 | 1.99993e-41 | 2 | 134 | 273 | 407 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1ib4_B | 0.0000003 | 10 | 124 | 224 | 336 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
PDB | 1ib4_A | 0.0000003 | 10 | 124 | 224 | 336 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
PDB | 1ia5_A | 0.0000003 | 10 | 124 | 224 | 336 | A Chain A, Polygalacturonase From Aspergillus Aculeatus |
PDB | 1bhe_A | 0.0002 | 1 | 87 | 260 | 344 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
PDB | 1nhc_F | 0.0007 | 6 | 124 | 215 | 333 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GR105020 | 135 | 1 | 135 | 0 |
GR131748 | 135 | 1 | 135 | 0 |
GR144924 | 135 | 1 | 135 | 0 |
GO991374 | 134 | 1 | 134 | 0 |
GO980666 | 134 | 1 | 134 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|