y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_10389235g0010
FamilyCE13
Protein PropertiesLength: 102 Molecular Weight: 11257.8 Isoelectric Point: 4.4997
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1311000
  MVRYCDGSSFTGDVEEVDQVSKLHLRGKRIWQAVMEDLLAQGMDKAEQALLTGCSAGGLATFIHCDEFHDLLPKSAKVKCMPDAGFFMDSEDVAGLNQFR
Full Sequence
Protein Sequence     Length: 102     Download
MVRYCDGSSF TGDVEEVDQV SKLHLRGKRI WQAVMEDLLA QGMDKAEQAL LTGCSAGGLA    60
TFIHCDEFHD LLPKSAKVKC MPDAGFFMDS EDVAGLNQFR DL                       120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE1.0e-531100100+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG39759.18.40779e-45296122216carboxylic ester hydrolase [Zea mays]
RefSeqNP_001047850.12e-40296121215Os02g0702400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001053773.19.99995e-41299194290Os04g0602500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151183.18.40779e-45296122216LOC100284816 [Zea mays]
RefSeqXP_002454426.12.8026e-45296122216hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO15943510011000
CO16978210211020
DV97174710211020
EX33501110211020
GE47453010211020
Orthologous Group
SpeciesID
Arabidopsis lyrata906276
Picea abiesMA_10389648g0010MA_10376612g0010MA_10432132g0010MA_97009g0010MA_74967g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny