y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_97009g0010
FamilyCE13
Protein PropertiesLength: 104 Molecular Weight: 11391 Isoelectric Point: 5.01
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE131946.1e-34
  MEDLLAQGLDRAQQALLTGCSAGGLATFIHCNDFRDLLSKSADVKCMADAGFFMDLEDVAGRNLFKLYNNDVVTFHESLKHLPDACTSKMDPGS
Full Sequence
Protein Sequence     Length: 104     Download
MEDLLAQGLD RAQQALLTGC SAGGLATFIH CNDFRDLLSK SADVKCMADA GFFMDLEDVA    60
GRNLFKLYNN DVVTFHESLK HLPDACTSKM DPGSLSLSNH HFLL                     120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE4.0e-3719494+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABR16604.11e-311100195294unknown [Picea sitchensis]
EMBLCAD41867.23e-30192157248OSJNBa0041A02.14 [Oryza sativa (japonica cultivar-group)]
GenBankEEC77932.17e-30192291382hypothetical protein OsI_17271 [Oryza sativa Indica Group]
GenBankEEE61621.19e-31192431522hypothetical protein OsJ_16047 [Oryza sativa Japonica Group]
RefSeqNP_001053773.13e-30192227318Os04g0602500 [Oryza sativa (japonica cultivar-group)]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO24197810311030
CF66715810311030
CF67166810311030
CO15943510311033.9937e-43
GW76386410221036e-37
Orthologous Group
SpeciesID
Arabidopsis lyrata906276
Picea abiesMA_10389648g0010MA_10376612g0010MA_10389235g0010MA_10432132g0010MA_74967g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny