y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_10432132g0010
FamilyCE13
Protein PropertiesLength: 262 Molecular Weight: 29566.7 Isoelectric Point: 8.5425
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1311570
  MEGGGWCNNITSCFKRAQSRLGSSVYMAGKLPFSGILGDNQTQNPDFYNWNRVKIRYCDGASLTGDMQEVNEIYKLYYRGQRIWQAVIDNLLRKGMDKAE
  QTLLSGCSAVGLTSFLHCDNFKELLPETAEVKCLGDAGFFIDEQVQIVQENSTDVML
Full Sequence
Protein Sequence     Length: 262     Download
MEGGGWCNNI TSCFKRAQSR LGSSVYMAGK LPFSGILGDN QTQNPDFYNW NRVKIRYCDG    60
ASLTGDMQEV NEIYKLYYRG QRIWQAVIDN LLRKGMDKAE QTLLSGCSAV GLTSFLHCDN    120
FKELLPETAE VKCLGDAGFF IDEQVQIVQE NSTDVMLYRI ALSVIQPQST SSKESTRKKK    180
RGKKHPNNTQ QNEGNPTALK GCEHCQKNRH MKDQCSKLHL ELILRNKQGK EYLMTKNAHM    240
LQVELAKIED LAESSSKVAC VT                                             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE3.0e-781142142+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24433.10114271212unknown [Picea sitchensis]
GenBankABK24994.10114271212unknown [Picea sitchensis]
GenBankACG39759.10117268243carboxylic ester hydrolase [Zea mays]
RefSeqNP_001151183.10117268243LOC100284816 [Zea mays]
RefSeqXP_002454426.10117168242hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX24970814211420
DR79834314411440
DR79191914411440
CO52483714411440
FE51966814211420
Orthologous Group
SpeciesID
Arabidopsis lyrata906276
Picea abiesMA_10389648g0010MA_10376612g0010MA_10389235g0010MA_97009g0010MA_74967g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny