y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_10389648g0010
FamilyCE13
Protein PropertiesLength: 105 Molecular Weight: 11695.5 Isoelectric Point: 4.7834
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE131904.06377e-44
  MVRYCDGSSFTGDVEEVDQVSKLHLRGKRIWQAVMEDLLAQGMDKAEQALLTGCSAGGLATFIHCDEFHDLLPKSAKVKCMPDAGFFMDS
Full Sequence
Protein Sequence     Length: 105     Download
MVRYCDGSSF TGDVEEVDQV SKLHLRGKRI WQAVMEDLLA QGMDKAEQAL LTGCSAGGLA    60
TFIHCDEFHD LLPKSAKVKC MPDAGFFMDS YVLNNILFDI IQVHI                    120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE9.0e-511104110+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG39759.19.00054e-42289122209carboxylic ester hydrolase [Zea mays]
EMBLCAD41867.24e-39289124211OSJNBa0041A02.14 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001053773.18e-39289194281Os04g0602500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151183.18.00001e-42289122209LOC100284816 [Zea mays]
RefSeqXP_002454426.13.99931e-42289122209hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO159435901900
FY842616882890
CO169782901900
EX33501111011040
DV971747901900
Orthologous Group
SpeciesID
Arabidopsis lyrata906276
Picea abiesMA_10376612g0010MA_10389235g0010MA_10432132g0010MA_97009g0010MA_74967g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny