| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_688105g0010 |
| Family | GH17 |
| Protein Properties | Length: 107 Molecular Weight: 11677.1 Isoelectric Point: 7.5158 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 106 | 6.4e-35 |
| MRIFQANRDALKAFANSGFDVIVGVGNNELQLISSSQDAAYGWVNDNIRPLYPATNMKYIAVGNEVLPGTEYVSYLVPAMRNIQTAIQNANLQNNIRVST THSSGV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 107 Download |
| MRIFQANRDA LKAFANSGFD VIVGVGNNEL QLISSSQDAA YGWVNDNIRP LYPATNMKYI 60 AVGNEVLPGT EYVSYLVPAM RNIQTAIQNA NLQNNIRVST THSSGVS |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 1.0e-30 | 1 | 107 | 107 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAV66572.1 | 1e-33 | 2 | 106 | 61 | 164 | glucanase-like protein [Thuja occidentalis] |
| GenBank | ABC69706.1 | 8e-24 | 1 | 106 | 58 | 163 | beta-1,3-glucanase [Zingiber officinale] |
| GenBank | ABK23947.1 | 0 | 2 | 107 | 60 | 165 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 2e-38 | 2 | 104 | 56 | 158 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 6e-40 | 1 | 106 | 60 | 168 | pollen allergen CJP38 [Cryptomeria japonica] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 3e-23 | 1 | 106 | 30 | 135 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur8_B | 1e-20 | 1 | 106 | 32 | 139 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur8_A | 1e-20 | 1 | 106 | 32 | 139 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3ur7_B | 1e-20 | 1 | 106 | 32 | 139 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 1e-20 | 1 | 106 | 32 | 139 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| AM170901 | 106 | 1 | 106 | 0 |
| AM171218 | 107 | 1 | 107 | 0 |
| GT739802 | 107 | 1 | 107 | 0 |
| EX376822 | 106 | 1 | 106 | 0 |
| CO482348 | 106 | 1 | 106 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |