y
Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 30333.m000034 |
Family | GH23 |
Protein Properties | Length: 133 Molecular Weight: 15159.6 Isoelectric Point: 9.8916 |
Chromosome | Chromosome/Scaffold: 30333 Start: 43 End: 444 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH23 | 7 | 116 | 6.2e-35 |
PKLVLAIIAVESNFQTKAQSPKAAMGLMQLIPETAERFNIKNAFDAAQNIKGGIRYLRWLLSYYHGDVALVAAAYNAGEKAVDRYKGVPPYPETKNYVKR VMELYQRKFH |
Full Sequence |
---|
Protein Sequence Length: 133 Download |
MWYSIDPKLV LAIIAVESNF QTKAQSPKAA MGLMQLIPET AERFNIKNAF DAAQNIKGGI 60 RYLRWLLSYY HGDVALVAAA YNAGEKAVDR YKGVPPYPET KNYVKRVMEL YQRKFHPYDE 120 KFTLPSPIIT RAG 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG4623 | COG4623 | 1.0e-12 | 5 | 84 | 86 | + Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] | ||
PRK11619 | PRK11619 | 2.0e-14 | 4 | 115 | 137 | + lytic murein transglycosylase; Provisional | ||
COG0741 | MltE | 2.0e-21 | 3 | 121 | 141 | + Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell envelope biogenesis, outer membrane] | ||
pfam01464 | SLT | 6.0e-25 | 3 | 93 | 97 | + Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems. | ||
cd00254 | LT_GEWL | 1.0e-32 | 7 | 112 | 113 | + Lytic Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002537173.1 | 0 | 1 | 133 | 1 | 133 | lytic transglycosylase, putative [Ricinus communis] |
RefSeq | YP_003050320.1 | 0 | 2 | 133 | 189 | 320 | Lytic transglycosylase catalytic [Methylovorus sp. SIP3-4] |
RefSeq | YP_524996.1 | 0 | 2 | 133 | 194 | 325 | lytic transglycosylase, catalytic [Rhodoferax ferrireducens T118] |
RefSeq | YP_547170.1 | 0 | 2 | 127 | 200 | 325 | lytic transglycosylase, catalytic [Polaromonas sp. JS666] |
RefSeq | ZP_04764704.1 | 0 | 3 | 133 | 166 | 296 | Lytic transglycosylase catalytic [Acidovorax delafieldii 2AN] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1qte_A | 0.0000009 | 10 | 108 | 471 | 592 | A Chain A, Lip5(mit)2 |
PDB | 1qsa_A | 0.0000009 | 10 | 108 | 471 | 592 | A Chain A, Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution |
PDB | 1sly_A | 0.000001 | 10 | 108 | 471 | 592 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
PDB | 4hjv_E | 0.0008 | 3 | 43 | 50 | 90 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
PDB | 4hjv_D | 0.0008 | 3 | 43 | 50 | 90 | A Chain A, Complex Of The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX918635 | 64 | 5 | 68 | 0.000001 |
HO423184 | 108 | 23 | 111 | 0.0002 |
EH222229 | 67 | 5 | 68 | 0.007 |
FE625482 | 103 | 9 | 96 | 0.019 |
GT022377 | 89 | 9 | 88 | 0.022 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Picea abies | MA_158766g0100 | MA_158760g0070 | MA_159146g0030 | MA_159036g0330 | |
Ricinus communis | 28599.m000063 | 30692.m000027 | 33357.m000019 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|