Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 915838 |
Family | CBM43 |
Protein Properties | Length: 100 Molecular Weight: 10818.3 Isoelectric Point: 8.1952 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 13 | 94 | 4e-24 |
WCVVKPGTPIQQLLKNINYVCSKINCDILSNASACYSSLNLYNLASVSMNLYYQSQGRQFSTCDFGGSGLISVTDPSCGCCK |
Full Sequence |
---|
Protein Sequence Length: 100 Download |
MRVNAQAPSQ GSWCVVKPGT PIQQLLKNIN YVCSKINCDI LSNASACYSS LNLYNLASVS 60 MNLYYQSQGR QFSTCDFGGS GLISVTDPSC GCCKYEFHK* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-13 | 12 | 81 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 7.0e-23 | 12 | 95 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64040.1 | 9e-39 | 1 | 89 | 23 | 113 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 1e-29 | 1 | 99 | 22 | 120 | At2g43670 [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 1e-29 | 1 | 99 | 23 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_850398.1 | 2.00386e-43 | 1 | 99 | 22 | 122 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_973680.1 | 2.00386e-43 | 1 | 99 | 23 | 123 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-16 | 9 | 96 | 9 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BP596959 | 102 | 1 | 100 | 2.99878e-43 |
AU227421 | 102 | 1 | 100 | 3.9937e-43 |
AU236487 | 81 | 1 | 79 | 2e-31 |
GE522216 | 98 | 3 | 100 | 3e-29 |
EE657217 | 96 | 5 | 100 | 3e-29 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|