Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT1G78520.1 |
Family | CBM43 |
Protein Properties | Length: 116 Molecular Weight: 13039.9 Isoelectric Point: 7.6544 |
Chromosome | Chromosome/Scaffold: 1 Start: 29537976 End: 29538656 |
Description | X8 domain containing protein, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 32 | 112 | 4.9e-29 |
WCVAKPSSDQVALQDNINFACSHVDCRVLLSGCPCYSPSNLINHASIAMNLYYQANGRNYWNCNFKNSGLITITNPSYGNC |
Full Sequence |
---|
Protein Sequence Length: 116 Download |
MAKAWICLSF LIFLYLVSER NFINVNAETK TWCVAKPSSD QVALQDNINF ACSHVDCRVL 60 LSGCPCYSPS NLINHASIAM NLYYQANGRN YWNCNFKNSG LITITNPSYG NCYYE* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-16 | 31 | 100 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-32 | 31 | 114 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAT41831.1 | 1.00053e-42 | 6 | 115 | 5 | 117 | At2g43670 [Arabidopsis thaliana] |
RefSeq | NP_177973.4 | 0 | 1 | 115 | 1 | 115 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 1.4013e-45 | 1 | 115 | 1 | 118 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002300444.1 | 1.99965e-42 | 28 | 114 | 28 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 1.4013e-45 | 1 | 114 | 1 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-21 | 31 | 115 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |