y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.013G167400.3
FamilyGH1
Protein PropertiesLength: 486 Molecular Weight: 55018.2 Isoelectric Point: 7.0689
ChromosomeChromosome/Scaffold: 13 Start: 45177705 End: 45184096
Descriptionbeta-glucosidase 45
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1391560
  FEFPDNFLFGTAVSSYQVEGGYLEDGKGLSNWDVFTHIPGNIKNNENGDDADDDYHLFLEDAEIAQSLGVNAYRFSISWARILPRGRFGEVNPGGIKFYN
  KIIDNLLLREMSYVRGLY
GH11504470
  SYVRGLYPPAHCSPPFGNCSVGNADIEPLIVVHNMLLAHGKAVKLYRERFQSKQGGSIGLVVQSHMYEPLRDVESDRQAVNRALAFTGGWVLDPLVFGDY
  PPEMRQYHRSELPRFSSEETEYMKGSIDFIGLNHYSTLYAKDCIHSPCVLGGDHFIRGFTFTTGERDGTLIGEPTGVERFYVVPRGMEKIVDHVSKRYNN
  MPIYVTENGYCPPLTEAAPNLLHDVNRVHFYNGYLAALARAIRKGADVRGYFAWSLMDNFEWAGGYSSTFGLYYVDRLTMNRTPKLSAKWFQHFLANR
Full Sequence
Protein Sequence     Length: 486     Download
MPVNDIIHVS LMFFVVYLLV SSTSNAEGFE IESQDVRRFE FPDNFLFGTA VSSYQVEGGY    60
LEDGKGLSNW DVFTHIPGNI KNNENGDDAD DDYHLFLEDA EIAQSLGVNA YRFSISWARI    120
LPRGRFGEVN PGGIKFYNKI IDNLLLREMS YVRGLYPPAH CSPPFGNCSV GNADIEPLIV    180
VHNMLLAHGK AVKLYRERFQ SKQGGSIGLV VQSHMYEPLR DVESDRQAVN RALAFTGGWV    240
LDPLVFGDYP PEMRQYHRSE LPRFSSEETE YMKGSIDFIG LNHYSTLYAK DCIHSPCVLG    300
GDHFIRGFTF TTGERDGTLI GEPTGVERFY VVPRGMEKIV DHVSKRYNNM PIYVTENGYC    360
PPLTEAAPNL LHDVNRVHFY NGYLAALARA IRKGADVRGY FAWSLMDNFE WAGGYSSTFG    420
LYYVDRLTMN RTPKLSAKWF QHFLANRSSA RFNRQRFVNP TPKSRRVRKS KYIVIATTNA    480
NATDV*                                                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028148.0e-288144137+
pfam00232Glyco_hydro_11.0e-4138147110+
PLN02849PLN028492.0e-70134449318+
PLN02814PLN028141.0e-72126444325+
pfam00232Glyco_hydro_19.0e-76150446301+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002281986.104144636504PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305594.10124451495predicted protein [Populus trichocarpa]
RefSeqXP_002329151.10381491112predicted protein [Populus trichocarpa]
RefSeqXP_002329151.10145444169469predicted protein [Populus trichocarpa]
RefSeqXP_002448179.103645137516hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rgm_B03644415479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A03644415479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgl_B03644415479A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB2rgl_A03644415479A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB3f5l_B03644415479A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8034122592284860
JK7904682022824830
JK7906532002824810
FF5475362791544300
CO0805971783094860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)