y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G113600.1
FamilyGT4
Protein PropertiesLength: 460 Molecular Weight: 51797.2 Isoelectric Point: 8.6552
ChromosomeChromosome/Scaffold: 10 Start: 37887552 End: 37893551
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42624221.3e-25
  TEIPVIISVAQFRPEKAHTLQLEAFSAAIKKLDPTLPKPKLQIVGSCRNKSDDDRLQMLKKKAIELNISEQVEFHKNVTYRDLVGLLGGAVAGIHSMTDE
  HFGISVVEYMAAGAIPIAHNSAGPKMDIVLDEDGQQTGFLACTVEEYADALVKTVTMPEME
Full Sequence
Protein Sequence     Length: 460     Download
MLTMIIVALI TAILFGFCIA PVNGRRRRNR AVGFFHPYTN DGGGGERVLW CAVRGIQEEI    60
PDLDCYIYTG DHDATPQSLM ARALDRFGVT LLSPPKVVHL YKRKWIEETT YPHFTMIGQS    120
LGSMYLAWEA LCKLTPLYYF DTSGYAFTYP LARLFGCKVI CYTHYPTISS DMLSRVRERS    180
LMYNNDALIT KSVWLSRCKI VYYTFFSCLY GIAGSCAHLA MVNSSWTKSH IENLWKVPDR    240
IKRVYPPCDT SGLQVLPLER STEIPVIISV AQFRPEKAHT LQLEAFSAAI KKLDPTLPKP    300
KLQIVGSCRN KSDDDRLQML KKKAIELNIS EQVEFHKNVT YRDLVGLLGG AVAGIHSMTD    360
EHFGISVVEY MAAGAIPIAH NSAGPKMDIV LDEDGQQTGF LACTVEEYAD ALVKTVTMPE    420
MERLKMAAAA RRRAKRFSEQ RFYDDFKAAV RPILCHVSR*                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03801GT1_YqgM_like1.0e-15212414212+
pfam00534Glycos_transf_15.0e-16265412150+
cd03805GT1_ALG2_like3.0e-18150442311+
PLN02949PLN02949036459424+
cd03806GT1_ALG11_like036445413+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA99697.103145431454glycosyl transferase, group 1 family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_181548.202345427458glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002271550.102345828463PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318120.102245929466predicted protein [Populus trichocarpa]
RefSeqXP_002528312.102245928465glycosyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A0.0000000226843727177A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB2xa1_B0.002263436230396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2xa1_A0.002263436230396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2x6r_B0.002263436230396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2x6r_A0.002263436230396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
Transmembrane Domains
StartEnd
524
200222
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY263372362363860
DY29937832943290
DY26990832853290
FC888865291363260
DY300206355363860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00152.10Aquca_045_00152.3Aquca_045_00152.4Aquca_045_00152.7Aquca_045_00152.8
Aquca_045_00152.2Aquca_045_00152.1Aquca_013_00559.1Aquca_013_00559.3
Arabidopsis lyrata497266
Arabidopsis thalianaAT2G40190.1
Brachypodium distachyonBradi4g03380.2
Brassica rapaBra004979Bra017025
Capsella rubellaCarubv10023116m
Chlamydomonas reinhardtiig1252.t1
Citrus clementinaCiclev10031450m
Citrus sinensisorange1.1g012436m
Cucumis sativusCucsa.368390.1
Eucalyptus grandisEucgr.G03076.1
Glycine maxGlyma16g02840.1Glyma07g06210.1
Gossypium raimondiiGorai.013G017200.1
Linum usitatissimumLus10028977
Manihot esculentacassava4.1_010258m
Medicago truncatulaAC235758_14.1AC233112_1009.1
Mimulus guttatusmgv1a005920m
Oryza sativaLOC_Os12g39340.1
Panicum virgatumPavirv00014744mPavirv00065689m
Physcomitrella patensPp1s269_93V6.1
Populus trichocarpaPotri.012G095500.1
Prunus persicappa005444m
Ricinus communis29814.m000733
Setaria italicaSi021990m
Selaginella moellendorffii80274
Sorghum bicolorSb08g019540.1
Thellungiella halophilaThhalv10016619m
Vitis viniferaGSVIVT01032791001
Volvox carteriVocar20008969m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny