Basic Information | |
---|---|
Species | Capsella rubella |
Cazyme ID | Carubv10015550m |
Family | CBM43 |
Protein Properties | Length: 119 Molecular Weight: 13342 Isoelectric Point: 4.1464 |
Chromosome | Chromosome/Scaffold: 3 Start: 9910685 End: 9911063 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 15 | 93 | 1.3e-30 |
WCVVDSQIPDYVIQAALDWACRQGGVDCTQIQPNQPCFEPNTLKDHASFVFNSYYQIYKHRGAECYFNSAGILTQNDPN |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MCVFIYIAKA EFGQWCVVDS QIPDYVIQAA LDWACRQGGV DCTQIQPNQP CFEPNTLKDH 60 ASFVFNSYYQ IYKHRGAECY FNSAGILTQN DPNPFVNSSL ISLINQDLEP SASDYLMV* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-17 | 14 | 86 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-29 | 14 | 92 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 3e-33 | 3 | 93 | 19 | 109 | unknown [Populus trichocarpa] |
RefSeq | NP_001154494.1 | 4.99997e-41 | 1 | 93 | 1 | 93 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 0 | 1 | 118 | 1 | 124 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_198423.1 | 1e-32 | 8 | 93 | 23 | 109 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002307902.1 | 3e-33 | 3 | 93 | 18 | 108 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000000000002 | 13 | 92 | 11 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FF146809 | 86 | 8 | 93 | 1e-33 |
EL462196 | 86 | 8 | 93 | 8e-33 |
DK539002 | 87 | 8 | 93 | 8e-33 |
DK479406 | 87 | 8 | 93 | 8e-33 |
DK457624 | 87 | 8 | 93 | 1e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|