Basic Information | |
---|---|
Species | Thellungiella halophila |
Cazyme ID | Thhalv10003112m |
Family | CBM43 |
Protein Properties | Length: 112 Molecular Weight: 12915.7 Isoelectric Point: 8.5868 |
Chromosome | Chromosome/Scaffold: 4 Start: 3748078 End: 3748413 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 35 | 112 | 6.8e-29 |
WCVANKEAPDDVLQAALESACQHGGADCSKIKPNNPCFLPNTIKDHASFVFNIYYQNYKHKGGFCYFNRAAMITDRDP |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
VKHYYNIHSH KHISHTYICI LFHKKTKTDA EIKQWCVANK EAPDDVLQAA LESACQHGGA 60 DCSKIKPNNP CFLPNTIKDH ASFVFNIYYQ NYKHKGGFCY FNRAAMITDR DP 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd08881 | RHO_alpha_C_NDO-like | 0.009 | 31 | 60 | 30 | + C-terminal catalytic domain of the oxygenase alpha subunit of naphthalene 1,2-dioxygenase (NDO) and related aromatic ring hydroxylating dioxygenases. C-terminal catalytic domain of the oxygenase alpha subunit of naphthalene 1,2-dioxygenase (NDO) and related Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs, also known as aromatic ring hydroxylating dioxygenases). This domain binds non-heme Fe(II). RHOs utilize non-heme Fe(II) to catalyze the addition of hydroxyl groups to the aromatic ring, an initial step in the oxidative degradation of aromatic compounds. RHOs are composed of either two or three protein components, and are comprised of an electron transport chain (ETC) and an oxygenase. The ETC transfers reducing equivalents form the electron donor to the oxygenase component, which in turn transfers electrons to the oxygen molecules. The oxygenase components are oligomers, either (alpha)n or (alpha)n(beta)n. The alpha subunits are the catalytic components and have an N-terminal domain, which binds a Rieske-like 2Fe-2S cluster, and a C-terminal domain which binds the non-heme Fe(II). The Fe(II) is co-ordinated by conserved His and Asp residues. Proteins belonging to this subgroup include the terminal oxygenase alpha subunits of biphenyl dioxygenase, cumene dioxygenase from Pseudomonas fluorescens IP01, ethylbenzene dioxygenase, naphthalene 1,2-dioxygenase, nitrobenzene dioxygenase from Comamonas sp. strain JS765, toluene 2,3-dioxygenase from Pseudomonas putida F1, dioxin dioxygenase of Sphingomonas sp. Strain RW1, and the polycyclic aromatic hydrocarbons (PAHs)degrading ring-hydroxylating dioxygenase from Sphingomonas CHY-1. This subfamily belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. | ||
pfam07983 | X8 | 5.0e-16 | 34 | 106 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-29 | 34 | 112 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN67352.1 | 2e-35 | 26 | 112 | 20 | 106 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28425.1 | 2e-35 | 26 | 112 | 20 | 106 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_198423.1 | 1e-35 | 27 | 112 | 22 | 108 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002307902.1 | 3e-34 | 27 | 112 | 22 | 107 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002321180.1 | 9e-36 | 18 | 112 | 12 | 106 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000000000005 | 26 | 112 | 4 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT035040 | 95 | 18 | 112 | 1e-36 |
DK457624 | 102 | 12 | 112 | 3e-36 |
DK517252 | 102 | 12 | 112 | 3e-36 |
DK539002 | 102 | 12 | 112 | 3e-36 |
DK479406 | 102 | 12 | 112 | 3e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|