Basic Information | |
---|---|
Species | Citrus clementina |
Cazyme ID | Ciclev10018075m |
Family | CBM43 |
Protein Properties | Length: 107 Molecular Weight: 11280.4 Isoelectric Point: 4.0224 |
Chromosome | Chromosome/Scaffold: 2 Start: 31682606 End: 31682926 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 29 | 107 | 1.9e-32 |
WCVALAGASQIDLQNALDWACGLGKADCKAIQDGGLCYEPDTLVSHASYAFNNYYQQNGNSDIACNFGGTAAVTKHNPS |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
MEEKAETAVP VSFLSPPEGN TTFLDGTTWC VALAGASQID LQNALDWACG LGKADCKAIQ 60 DGGLCYEPDT LVSHASYAFN NYYQQNGNSD IACNFGGTAA VTKHNPS |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-20 | 28 | 99 | 81 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-34 | 28 | 107 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17215.1 | 0 | 1 | 107 | 26 | 132 | unknown [Glycine max] |
RefSeq | XP_002274294.1 | 0 | 1 | 107 | 5 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002332014.1 | 0 | 2 | 107 | 6 | 111 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332015.1 | 0 | 2 | 107 | 6 | 111 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002526606.1 | 0 | 1 | 106 | 6 | 111 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-16 | 28 | 107 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FK001098 | 107 | 1 | 107 | 0 |
DT019806 | 107 | 1 | 107 | 0 |
DT039619 | 107 | 1 | 107 | 0 |
DT019261 | 107 | 1 | 107 | 0 |
EX291939 | 106 | 2 | 107 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|