Basic Information | |
---|---|
Species | Setaria italica |
Cazyme ID | Si039775m |
Family | CBM43 |
Protein Properties | Length: 91 Molecular Weight: 10069.2 Isoelectric Point: 5.4504 |
Chromosome | Chromosome/Scaffold: 9 Start: 5458671 End: 5459025 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 85 | 4.6e-33 |
WCIADEQTPDDVLQQALNWACGPGGADCTMIEPNKSCYLPNTVRDHASYAFNNYWRKFKKHGGTCYFNAAAIVTDLDPSHNSCH |
Full Sequence |
---|
Protein Sequence Length: 91 Download |
QWCIADEQTP DDVLQQALNW ACGPGGADCT MIEPNKSCYL PNTVRDHASY AFNNYWRKFK 60 KHGGTCYFNA AAIVTDLDPS HNSCHFEPAT * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-16 | 1 | 73 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-34 | 1 | 86 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI28425.1 | 8.40779e-45 | 1 | 87 | 28 | 114 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002272811.1 | 2.99878e-43 | 1 | 87 | 29 | 115 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 2.99878e-43 | 1 | 87 | 29 | 115 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002321180.1 | 9.94922e-44 | 1 | 87 | 28 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 1.99965e-42 | 1 | 87 | 28 | 114 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000000000009 | 2 | 86 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FF557395 | 87 | 1 | 87 | 0 |
FL661214 | 87 | 1 | 87 | 1.4013e-45 |
DT035040 | 87 | 1 | 87 | 4.2039e-45 |
EE090966 | 87 | 1 | 87 | 9.80909e-45 |
CB918545 | 87 | 1 | 87 | 1.96182e-44 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|