Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a023060m |
Family | CBM43 |
Protein Properties | Length: 74 Molecular Weight: 8037.93 Isoelectric Point: 6.1982 |
Chromosome | Chromosome/Scaffold: 24 Start: 1617628 End: 1617951 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 68 | 1.1e-26 |
INWACGNGANCTAIQENQMCFFPNTTLDHASYAFNSYYQNMKHNGASCYFTAAAVLTALDPSHGSCK |
Full Sequence |
---|
Protein Sequence Length: 74 Download |
TINWACGNGA NCTAIQENQM CFFPNTTLDH ASYAFNSYYQ NMKHNGASCY FTAAAVLTAL 60 DPSHGSCKFE YLP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-12 | 2 | 56 | 64 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-27 | 2 | 69 | 68 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 3e-28 | 2 | 73 | 47 | 119 | unknown [Populus trichocarpa] |
RefSeq | XP_002272811.1 | 2e-28 | 2 | 73 | 46 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 2e-28 | 2 | 73 | 46 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307902.1 | 3e-28 | 2 | 73 | 46 | 118 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 6e-30 | 2 | 73 | 45 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000007 | 2 | 70 | 29 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GR126506 | 73 | 2 | 74 | 9e-34 |
GR126507 | 73 | 2 | 74 | 5e-33 |
GR132935 | 73 | 2 | 74 | 1e-32 |
GR132936 | 73 | 2 | 74 | 2e-32 |
AJ800516 | 74 | 1 | 74 | 3e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|