Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_032460m |
Family | CBM43 |
Protein Properties | Length: 118 Molecular Weight: 13023.8 Isoelectric Point: 4.7401 |
Chromosome | Chromosome/Scaffold: 03317 Start: 121864 End: 123200 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 29 | 112 | 4.2e-34 |
WCIADEQTPDGELQAALDWACGRGGADCSMIQVNQPCYLPNTVRDHASFAFNSYFQKFKHKGGSCYFRGAAIITELDPSHNSCH |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
MAIIWLRVLL ALLIISITPP SSDGELEQWC IADEQTPDGE LQAALDWACG RGGADCSMIQ 60 VNQPCYLPNT VRDHASFAFN SYFQKFKHKG GSCYFRGAAI ITELDPSHNS CHYEFIP* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-21 | 28 | 100 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-39 | 28 | 113 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI28425.1 | 0 | 18 | 117 | 18 | 117 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_198423.1 | 0 | 19 | 117 | 20 | 119 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002321180.1 | 0 | 1 | 117 | 1 | 117 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 0 | 10 | 117 | 10 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
RefSeq | XP_002531703.1 | 0 | 1 | 107 | 1 | 107 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.0000000000004 | 18 | 113 | 2 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |