y PlantCAZyme

CAZyme Information

Basic Information
SpeciesEucalyptus grandis
Cazyme IDEucgr.A01556.1
FamilyGH35
Protein PropertiesLength: 642 Molecular Weight: 72414.9 Isoelectric Point: 6.463
ChromosomeChromosome/Scaffold: 1 Start: 24522978 End: 24527015
Descriptionbeta-galactosidase 7
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35371002e-28
  LNGQSRIIISGSIHYPRSTPEMWGDLIKKAKEGGLNAIETYVFWNAHEPLYRQYDFEGNKDLVR
GH351013140
  GFPVWLHNLPGVELRTNNTVYQNEMKTFVTLVVDMMQKHGLFAIQGGPIIVAQIENEYGNVEWAYGNNGKSYINWCAQLAESYGIQVPWIMCQQSDAPSP
  MINTCNGWYCDQFSPNNPKSPKWWAENWSGWFKDWGMKDPHRTAEDLAFAVARFFQYGGSLQNYYMLFYSLGGTNFDRTAGGPYITTSYDYDAPLDEYGN
  LNKPKWGHLKRLHE
Full Sequence
Protein Sequence     Length: 642     Download
MATFGPCFAA VLSVVSFLLV ASAVPLNVSY DERGIKLNGQ SRIIISGSIH YPRSTPEMWG    60
DLIKKAKEGG LNAIETYVFW NAHEPLYRQY DFEGNKDLVR GFPVWLHNLP GVELRTNNTV    120
YQNEMKTFVT LVVDMMQKHG LFAIQGGPII VAQIENEYGN VEWAYGNNGK SYINWCAQLA    180
ESYGIQVPWI MCQQSDAPSP MINTCNGWYC DQFSPNNPKS PKWWAENWSG WFKDWGMKDP    240
HRTAEDLAFA VARFFQYGGS LQNYYMLFYS LGGTNFDRTA GGPYITTSYD YDAPLDEYGN    300
LNKPKWGHLK RLHELIMSME EILTRGVKRD VGTVYMYEGK QSCFLGNANQ NQDFTVNLMG    360
SNYTVLAWSV SILPNCYTEV YNTAKTVMVK LPNEADDQME PYELKWDWRP EQPESLHQGI    420
AKGSVMTANE LLDQKTCRFE QECLTGKAIT LQVHTNGHII HAFVNGKHVG SQWGTGDHLE    480
FIMEKDIKLK HGKTNSISLL SVTVGLQYCE ANFDTVNVGI HGPVKLIGNK GQSDEVGLNG    540
MEEKVLQLDN AHHQHGWKSY NLPSNRLFEW YKTTFKAPMG SDPVVDLQGL GKGTAWVNGH    600
NIGRFWPSYV ASEDGCTTTC DYRGAYNSDK CLTNCRKPSQ R*                       660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA1.0e-1028306352+
pfam01301Glyco_hydro_352.0e-12137316322+
PLN03059PLN03059027641677+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ09953.1076413699beta-galactosidase [Mangifera indica]
EMBLCBI27773.10964121707unnamed protein product [Vitis vinifera]
EMBLCBI30211.102864130694unnamed protein product [Vitis vinifera]
RefSeqXP_002516237.1016411697beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.10864125719beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A3e-303731217325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D7e-24263229337A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D0.001549608508571A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C7e-24263229337A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160682276410
HO780602613786260
DW076707315273140
HO7955525211015850
HO7955525327792e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295
Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny