y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G057700.1
FamilyGH127
Protein PropertiesLength: 891 Molecular Weight: 100011 Isoelectric Point: 6.1883
ChromosomeChromosome/Scaffold: 11 Start: 4957673 End: 4964100
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273816636.1e-21
  TGDPLSKDIGTFFMETINSSHSYATGGTSVGEFWRDPKRIADTLKTTENEESCTTYNMLKVSRHLFRWTKEVSYADYYERALINGVLSIQRGTDPGVMIY
  MLPLGLGVSKAITFHGWGTPFDTFWCCYGTGIESFSKLGDSIYFEEEGKNPTLYVIQYISSSFNWKSGKLLLNQTVVPAASWDPYLRVTFTFSPFEKVLS
  DDENTWSALNFRLPTWTSLDGAKGILNGETLSLPAPGNYLSITRQWSASDNLTLQLPLTTRTEAIKDDRPEYASIHAILYGPY
Full Sequence
Protein Sequence     Length: 891     Download
IHYFPILYIS LLRAYAIIAI LPHFKNQIPR KMKGFVSVFV VLVLCGCAVA KECTNIPTQS    60
HTLMYELLSS KNETWKEEMM SHFHLTPTDE SAWADLLPRK FLSERQQHDW AVMYKKIKNM    120
GVFQSPEGFL KDVPLEDVRL HEYSIHGIAQ QTNLEYLLMF DVDRLIWSFR KTAGLPTPAA    180
PYGGWEEPGC ELRGHFVGHY LSASALMWAS TQNDNLKQKM TSLVAGLSAC QEKIGTGYLS    240
AFPSEFFDRV EAIKGVWAPY YTIHKILAGL LDQYTFAGNS HALNVVTWMV DYFYNRVQNV    300
ITKYTINRHY QSLNQETGGM NDVLYRLYSI TEDSKHMLLA QLFDKPCFLG LLAVQANDIA    360
DMHANTHIPI VVGSQRRYEI TGDPLSKDIG TFFMETINSS HSYATGGTSV GEFWRDPKRI    420
ADTLKTTENE ESCTTYNMLK VSRHLFRWTK EVSYADYYER ALINGVLSIQ RGTDPGVMIY    480
MLPLGLGVSK AITFHGWGTP FDTFWCCYGT GIESFSKLGD SIYFEEEGKN PTLYVIQYIS    540
SSFNWKSGKL LLNQTVVPAA SWDPYLRVTF TFSPFEKVLS DDENTWSALN FRLPTWTSLD    600
GAKGILNGET LSLPAPGNYL SITRQWSASD NLTLQLPLTT RTEAIKDDRP EYASIHAILY    660
GPYLLAGHTL GGDWDLKSGA NTSEWITPIP ESYNSQLVSF SQFFENSTFV LVNSNQSLGM    720
QKFPESGTDL ALQATFRLVP KESSSKFSTL ADANDRSVML EPFDLPGMNV IHQGADKPLL    780
IVDSSDGKPS SVFLVVPGLD GRNETISLES QSDKGCYVYS GLSSSAGVKL SCKSDSDATF    840
NQATSFISQK GLSQYNALSF VAKGLNRNFL LEPLFSFRDE HYTVYFNLKG *             900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35336.0e-69130667543+
pfam07944DUF16801.0e-160137666541+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196799.105188925860catalytic [Arabidopsis thaliana]
RefSeqXP_002283032.103189074940PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285548.10328891863PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.10328901858predicted protein [Populus trichocarpa]
RefSeqXP_002304762.10328891857predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
421
3456
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7810924114608700
GO8434393563306850
FE6817082925418320
ES8033983091204280
HO781092238698911.3
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny