| Basic Information | |
|---|---|
| Species | Setaria italica |
| Cazyme ID | Si023477m |
| Family | CE1 |
| Protein Properties | Length: 167 Molecular Weight: 18474.8 Isoelectric Point: 5.5211 |
| Chromosome | Chromosome/Scaffold: 3 Start: 194771 End: 199604 |
| Description | S-formylglutathione hydrolase |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE1 | 1 | 160 | 1.3e-33 |
| MYDYVVKELPEVVSGNFEQLNTSQASIFGHSMGGHGALTIYLKNTDKYKSVSAFAPIANPINCPWGQKAFSNYLGSTKSDWEEYDATCLIKKNNNAVSTP ILIDQGDADKFLAEEQLLPRNFEEACKAVGAPLILRMQPGYDHSYYFIATFVDDHTAHHA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 167 Download |
| MYDYVVKELP EVVSGNFEQL NTSQASIFGH SMGGHGALTI YLKNTDKYKS VSAFAPIANP 60 INCPWGQKAF SNYLGSTKSD WEEYDATCLI KKNNNAVSTP ILIDQGDADK FLAEEQLLPR 120 NFEEACKAVG APLILRMQPG YDHSYYFIAT FVDDHTAHHA QFLKSA* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG1506 | DAP2 | 0.004 | 19 | 159 | 164 | + Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | ||
| pfam00756 | Esterase | 8.0e-30 | 3 | 155 | 165 | + Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family. | ||
| COG0627 | COG0627 | 5.0e-55 | 1 | 166 | 187 | + Predicted esterase [General function prediction only] | ||
| TIGR02821 | fghA_ester_D | 4.0e-74 | 1 | 163 | 163 | + S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well [Cellular processes, Detoxification]. | ||
| PLN02442 | PLN02442 | 2.0e-114 | 1 | 165 | 165 | + S-formylglutathione hydrolase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004091 | carboxylesterase activity |
| GO:0016023 | cytoplasmic membrane-bounded vesicle |
| GO:0018738 | S-formylglutathione hydrolase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY77167.1 | 0 | 1 | 166 | 1 | 164 | hypothetical protein OsI_05135 [Oryza sativa Indica Group] |
| GenBank | EAZ14788.1 | 0 | 1 | 166 | 1 | 164 | hypothetical protein OsJ_04718 [Oryza sativa Japonica Group] |
| RefSeq | NP_001045351.1 | 0 | 1 | 166 | 129 | 292 | Os01g0939700 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001148438.1 | 0 | 1 | 166 | 126 | 290 | esterase D [Zea mays] |
| RefSeq | XP_002456916.1 | 0 | 1 | 166 | 120 | 284 | hypothetical protein SORBIDRAFT_03g045400 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3fcx_B | 0 | 1 | 165 | 120 | 282 | A Chain A, Crystal Structure Of Human Esterase D |
| PDB | 3fcx_A | 0 | 1 | 165 | 120 | 282 | A Chain A, Crystal Structure Of Human Esterase D |
| PDB | 3s8y_A | 0 | 1 | 165 | 121 | 280 | A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica |
| PDB | 3i6y_B | 0 | 1 | 165 | 121 | 280 | A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica |
| PDB | 3i6y_A | 0 | 1 | 165 | 121 | 280 | A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| formaldehyde oxidation II (glutathione-dependent) | S-FORMYLGLUTATHIONE-HYDROLASE-RXN | EC-3.1.2.12 | S-formylglutathione hydrolase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CA071168 | 167 | 1 | 167 | 0 |
| EH408684 | 167 | 1 | 167 | 0 |
| CD227402 | 167 | 1 | 167 | 0 |
| CN145994 | 167 | 1 | 167 | 0 |
| CN128886 | 167 | 1 | 167 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |