y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g002050m
FamilyCBM20
Protein PropertiesLength: 976 Molecular Weight: 112671 Isoelectric Point: 6.4149
ChromosomeChromosome/Scaffold: 00091 Start: 443610 End: 451959
Descriptiondisproportionating enzyme 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20241091.4e-21
  TVKFRIPYYTHWGQSLLVCGSEPVLGSWDVKKGFLLSPVHQDDELIWSGSIAVPIGFSCEYSYYVVDDRKNLLRWEMGKKRKLLLH
GH772799260
  VPMFSVRSEADLGVGEFLDLKLLVDWAVESGFHLVQLLPINDTSVNRMWWDSYPYSSLSVFALHPLYLRVQALSEKMPEDIKKEIEKAKVQLDKKDVDYE
  ATLATKLAIARKVFNQEKDLILNSSAFQNFFSENEDWLKPYAAFCFLRDFFDTSDHSQWGRFSHYSKDKLAKLISEDSLHYDIIRFHYYVQFHLHIQLSE
  AAEYARKKGVVLKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYAWWRARLTQMSKYFTAYRIDHILGFFRIWEL
  PEHAMTGLIGKFRPSIPLSQEELEREGIWDFDRLTRPYIRLEHLQEKFGSSWTYIAANFLSEFQKGRYEFTEDCNTEKKIAAKLKTCAEKSMLLDSEDKT
  RRDLFDLIQNIVLIRDPEDSKKFYPRFNLEDTSSFMDLDDHSKNVLKRLYYDYYFHRQENLWRENALKTLPALLNSSDMMACGEDLGLIPSCVHPVMEEL
  GLIGLRIQRMPSEPGLEFGIPSQYNYMTVCAPSCHDCSTLRAWWEEDEERRRRFFKNVVGSDALPPSQCLPDITHFILRQHVESPSMWAIFPLQDLLALK
  EDYTTRPATEETINDPTNPRHYWRYRVHVTLESLQKDKELKTTVKDLV
Full Sequence
Protein Sequence     Length: 976     Download
MANMGLFSGT KSSKPLTMSV KSLTVKFRIP YYTHWGQSLL VCGSEPVLGS WDVKKGFLLS    60
PVHQDDELIW SGSIAVPIGF SCEYSYYVVD DRKNLLRWEM GKKRKLLLHE TIKDGEVVEL    120
HDLWQTGGDA LPFRSAFKNV IFRRSFSLDI ERSDGLIQNK LEQEDSVLVR FKICIPNIEE    180
DASVYVIGST SMLGQWKLQN GLKLSYAGES VWEADCVIQR GDFPIKYKYC KSGKTGNISL    240
ETGANRNLNV DFSNNQPRYI FLSDGMMREM PWRGAGVAVP MFSVRSEADL GVGEFLDLKL    300
LVDWAVESGF HLVQLLPIND TSVNRMWWDS YPYSSLSVFA LHPLYLRVQA LSEKMPEDIK    360
KEIEKAKVQL DKKDVDYEAT LATKLAIARK VFNQEKDLIL NSSAFQNFFS ENEDWLKPYA    420
AFCFLRDFFD TSDHSQWGRF SHYSKDKLAK LISEDSLHYD IIRFHYYVQF HLHIQLSEAA    480
EYARKKGVVL KGDLPIGVDR NSVDTWVYPN LFRMNTSTGA PPDYFDKNGQ NWGFPTYNWE    540
EMSKDNYAWW RARLTQMSKY FTAYRIDHIL GFFRIWELPE HAMTGLIGKF RPSIPLSQEE    600
LEREGIWDFD RLTRPYIRLE HLQEKFGSSW TYIAANFLSE FQKGRYEFTE DCNTEKKIAA    660
KLKTCAEKSM LLDSEDKTRR DLFDLIQNIV LIRDPEDSKK FYPRFNLEDT SSFMDLDDHS    720
KNVLKRLYYD YYFHRQENLW RENALKTLPA LLNSSDMMAC GEDLGLIPSC VHPVMEELGL    780
IGLRIQRMPS EPGLEFGIPS QYNYMTVCAP SCHDCSTLRA WWEEDEERRR RFFKNVVGSD    840
ALPPSQCLPD ITHFILRQHV ESPSMWAIFP LQDLLALKED YTTRPATEET INDPTNPRHY    900
WRYRVHVTLE SLQKDKELKT TVKDLVCASG RSCPPGGQEV ASNTRDKQQV ASSQEKNPIS    960
KPLSGVPQKG TVAVV*                                                    1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02446Glyco_hydro_772.0e-43751925176+
PRK14508PRK145083.0e-74273593333+
pfam02446Glyco_hydro_777.0e-123279613337+
PLN02950PLN02950019922906+
PLN03236PLN032360251932709+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR99599.101993459194-alpha-glucanotransferase [Solanum tuberosum]
EMBLCBI32836.1019741967unnamed protein product [Vitis vinifera]
RefSeqXP_002278329.1019741967PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308854.1019731988predicted protein [Populus trichocarpa]
RefSeqXP_002323208.1019346892predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1tz7_B6e-2927359022329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_B0.0003760933351505A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A6e-2927359022329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A0.0003760933351505A Chain A, Aquifex Aeolicus Amylomaltase
PDB2x1i_A1e-2830762738343A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7946055574099650
HO7946052911204090
HO7797145091316380
HO4763014314759000
GO8378863154287420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)