y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa000782m
FamilyCBM20
Protein PropertiesLength: 1006 Molecular Weight: 115966 Isoelectric Point: 6.3532
ChromosomeChromosome/Scaffold: 7 Start: 1951515 End: 1961726
Descriptiondisproportionating enzyme 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20161041e-22
  VHVSFRIPYYTHWGQSLLVCGSEPVLGLWNLKKGLLLSPVHHGDELIWLGTVSVPKGFKCEYSYYVVDDNRNVLRWEMGEKRKVLLPEG
GH773059510
  IPMFSVRSEADLGVGEFLDLKLFVDWAAESGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSENIPEDIKLEIQKAKEQLDGKDVDYE
  ATLSTKLSIAKKIFAQEKDLILNSSSFQKFFSENQDWLKPYAAFCFLRDFFETSDHSQWGRFSHFSKEKLEKLVSKDSLHYSIICFHYYIQFHLHIQLSE
  AADYARKKGVILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYAWWRARLTQMAKYFTAYRIDHILGFFRIWEL
  PEHAMTGLVGKFRPSIPLSQEELEKEGIWDFDRLSRPYILQEFLQDKFGASWTFIASNFLNEYQKNRYEFKEDCNTEKKIASKLKSFPERSLLQDEDKIR
  RELFDLVQNIVLIRDPENPRNFYPRFNLEDTPSFKDLDDHSKNVLKRLYYDYYFHRQENLWQQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELG
  LIGLRIQRMPSEPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEERRQRYFKNVVGSDMSPPARCVPDIAHFIIREHVESPSMWAIFPLQDLLVLKE
  EYTTRPATEETINDPTNPKHYWRYRVHVTVEALIKDKELVSTIKDLV
Full Sequence
Protein Sequence     Length: 1006     Download
MVELGLLSGT KSTKPVHVSF RIPYYTHWGQ SLLVCGSEPV LGLWNLKKGL LLSPVHHGDE    60
LIWLGTVSVP KGFKCEYSYY VVDDNRNVLR WEMGEKRKVL LPEGIQDGEV VELHDLWQVG    120
SDALPLKSAF KDVIFRRKLS LDIETPLGVI RSTLDQKDSV LVHFKISCPN IEEETSVTVP    180
FSLVNYSDLT AIMLINIILD SIYKVWFLQI YIIGNTLKLG QWNVQNGLKL SYSGESIWHA    240
DCVLPKGDFP IKYKYCKYGK GGIFSPETGP NRDIALDSSN TQPRYIFLSD GMLREMPWRG    300
AGVAIPMFSV RSEADLGVGE FLDLKLFVDW AAESGFHLVQ LLPINDTSVH GMWWDSYPYS    360
SLSVFALHPL YLRVQALSEN IPEDIKLEIQ KAKEQLDGKD VDYEATLSTK LSIAKKIFAQ    420
EKDLILNSSS FQKFFSENQD WLKPYAAFCF LRDFFETSDH SQWGRFSHFS KEKLEKLVSK    480
DSLHYSIICF HYYIQFHLHI QLSEAADYAR KKGVILKGDL PIGVDRNSVD TWVYPNLFRM    540
NTSTGAPPDY FDKNGQNWGF PTYNWEEMSK DNYAWWRARL TQMAKYFTAY RIDHILGFFR    600
IWELPEHAMT GLVGKFRPSI PLSQEELEKE GIWDFDRLSR PYILQEFLQD KFGASWTFIA    660
SNFLNEYQKN RYEFKEDCNT EKKIASKLKS FPERSLLQDE DKIRRELFDL VQNIVLIRDP    720
ENPRNFYPRF NLEDTPSFKD LDDHSKNVLK RLYYDYYFHR QENLWQQNAL KTLPALLNSS    780
DMLACGEDLG LIPSCVHPVM QELGLIGLRI QRMPSEPDLE FGIPSQYSYM TVCAPSCHDC    840
STLRAWWEED EERRQRYFKN VVGSDMSPPA RCVPDIAHFI IREHVESPSM WAIFPLQDLL    900
VLKEEYTTRP ATEETINDPT NPKHYWRYRV HVTVEALIKD KELVSTIKDL VSGSGRSHPG    960
GQAERQASHK SAVATTEKQQ IASSKDKVHL ATPLNSVAHE TLAVR*                   1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02446Glyco_hydro_778.0e-46776950176+
COG1640MalQ9.0e-74302606307+
pfam02446Glyco_hydro_779.0e-121305637335+
PLN02950PLN0295008947943+
PLN03236PLN032360265957721+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAR99599.10896649314-alpha-glucanotransferase [Solanum tuberosum]
EMBLCBI32836.10110041967unnamed protein product [Vitis vinifera]
RefSeqXP_002278329.10110041967PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308854.10110041988predicted protein [Populus trichocarpa]
RefSeqXP_002323208.1019786912predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1tz7_B2e-2929961622329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_B0.0007785957351504A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A2e-2929961622329A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A0.0007785957351504A Chain A, Aquifex Aeolicus Amylomaltase
PDB1x1n_A2e-2731463144361A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79460557343510060
HO7946053241134350
HO7797145431236640
HO4763014315019250
GT0376473265658890
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1
Glyma0165s00200.1Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1
Glyma19g30580.1.16.102Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)