y PlantCAZyme

CAZyme Information

Basic Information
SpeciesMalus domestica
Cazyme IDMDP0000313820
FamilyGH9
Protein PropertiesLength: 884 Molecular Weight: 97964.1 Isoelectric Point: 6.7184
ChromosomeChromosome/Scaffold: 020266309 Start: 13530 End: 20124
Descriptionglycosyl hydrolase 9A1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91182155.3e-28
  TRALNQALTFFDAQISGVYPNNSXVKFRASSGLHDGNLSSKPVNLRGGFYDSGNNIKFSFPTAYTVTLLSWTVIEYHEKYADIGELDHVKDIIKWGXE
GH92155330
  EIIAALSAASLVFKEDNAYSGELVTAAEKLYESAVTKLDPARQGVYTKVDACGGESRNFYNSSGFQDELVWGGTWLFFATGDNSYLDYATKEFKYAVANE
  TSADKGIFFWNNKLTANAVLLTRLRYFRDLGFPYESSLDAGSDITDTLMCSYISSPKTTPGGLLLQRPTYGARAPLEYAATASFLSKLYSDYLDLLRSSG
  GSCINFGFSVDMLRNFSITQAXVNYILGDNXMKMSYMVGFGDKFPTQVHHRSASIPWDGHQYSCEDGEKWKNSKDPNPNLLLGAMVAGPDELDKFVDERD
  KQEFTEPSIASNAGLVAAL
Full Sequence
Protein Sequence     Length: 884     Download
MTSSLGSQTQ ASAADLEPVR FVHTVSEARR LLPSASRWNS IEIDYNLVPQ SSIANDSIPS    60
PYSKSYEFNL VITDKNYLKR CLYISASTIF VVLALILLVA LLPNALQKHH RHPSKNLTRA    120
LNQALTFFDA QISGVYPNNS XVKFRASSGL HDGNLSSKPV NLRGGFYDSG NNIKFSFPTA    180
YTVTLLSWTV IEYHEKYADI GELDHVKDII KWGXEIIAAL SAASLVFKED NAYSGELVTA    240
AEKLYESAVT KLDPARQGVY TKVDACGGES RNFYNSSGFQ DELVWGGTWL FFATGDNSYL    300
DYATKEFKYA VANETSADKG IFFWNNKLTA NAVLLTRLRY FRDLGFPYES SLDAGSDITD    360
TLMCSYISSP KTTPGGLLLQ RPTYGARAPL EYAATASFLS KLYSDYLDLL RSSGGSCINF    420
GFSVDMLRNF SITQAXVNYI LGDNXMKMSY MVGFGDKFPT QVHHRSASIP WDGHQYSCED    480
GEKWKNSKDP NPNLLLGAMV AGPDELDKFV DERDKQEFTE PSIASNAGLV AALIALHDPP    540
RHRSSKANGT HLGIDQTGIF EKLRYDIEXS SGMLVSGDGL IRLGLRCCYS LSSWVAAIXX    600
IVELRLKFLE PCVQSIRQTF SRDIPPHNSG QKKEETEAPC SKSNRGQILN QSFKQTAGEL    660
TRRKXKMPIT QGPSXGVFFG FTSRLSFQRG SSEAATGAVS GGSAARDFFR QLLGGGTDAP    720
IRDPGGSCWV LYRLIALVAA SELDRDASRG QEEEEGGXSD HXVPRLKESL QSWLIEFEAE    780
LRKGNYSNPA IXTMRRWRTC DVEFQSYFTL NDQWESFREX SAYGAGVPLV LNNSDSVVQY    840
YVPYISGIQL YVESSAKLNA KSRNISMMFY GGHPMTSTTG FQGM                     900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02345PLN023452.0e-64226536322+
PLN02340PLN023402.0e-65116540484+
PLN02266PLN022666.0e-67109536490+
PLN00119PLN001195.0e-68114536481+
pfam00759Glyco_hydro_92.0e-86116533471+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ63883.101853911586cellulase [Medicago truncatula]
EMBLCAN71528.101556414607hypothetical protein [Vitis vinifera]
EMBLCBI19980.101542314490unnamed protein product [Vitis vinifera]
RefSeqXP_002278065.101556414618PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002526151.10125646600endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A9.94922e-441195367428A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8
PDB1ksc_A9.94922e-441195367428A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Thermus Thermophilus Hb8
PDB1ks8_A9.94922e-441195367428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B9.94922e-441135362440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A9.94922e-441135362440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
81103
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7946744921165360
EL3537752692735360
EY0809052692735360
EX3331343022675630
DR5799773022675630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)