y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G239600.6
FamilyGH5
Protein PropertiesLength: 456 Molecular Weight: 50517.1 Isoelectric Point: 7.1958
ChromosomeChromosome/Scaffold: 09 Start: 19103080 End: 19105756
Description
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52134192.6e-37
  ENAPQVMREHWRTFIVEKDFKFISQNGLNAVRIPVGWWIASDPTPPPPFVGGSLQALDNAFQWAKKYGLKVIIDLHAAPGSQNGWEHSGSRDSSQEWGKT
  DETITQTVAVIDFLASRYANSPSLYAVELINEPLSPGATLSSVIEYYKAGYAAVRRHTSTAFVVMSNRLGPMKPRELFPIASGFKRSVIDVHYYNLFEDM
  FNNMTVQ
Full Sequence
Protein Sequence     Length: 456     Download
MLVSSTMHLL SMCVLSLVLS CCQGREDPNF RIRAVNLGGW LVTEGWIKPS LFDGIVNKDF    60
LDGTALQFKS VTTGKYLSAE QGGGSIIVAN RTTASGWETF RLWRINETAF NFRVFGKQFI    120
GVDTDGNGIG IVAISKAPGH SETFEILRNS DDKNRVRIKA SNGYYLQAKT EEVVTADSQG    180
NKGWGDDDPS VFVMKMTGRL EGEFQVTNGY GPENAPQVMR EHWRTFIVEK DFKFISQNGL    240
NAVRIPVGWW IASDPTPPPP FVGGSLQALD NAFQWAKKYG LKVIIDLHAA PGSQNGWEHS    300
GSRDSSQEWG KTDETITQTV AVIDFLASRY ANSPSLYAVE LINEPLSPGA TLSSVIEYYK    360
AGYAAVRRHT STAFVVMSNR LGPMKPRELF PIASGFKRSV IDVHYYNLFE DMFNNMTVQQ    420
NIDFVYNNRS SQLNYVTTSN GPLTFVGKNG WSVLM*                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin9.0e-968178111+
pfam00150Cellulase6.0e-11222406192+
COG2730BglC1.0e-29222368149+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18831.10644812447unnamed protein product [Vitis vinifera]
EMBLCBI33033.10644812447unnamed protein product [Vitis vinifera]
EMBLCBI33035.10644812447unnamed protein product [Vitis vinifera]
RefSeqXP_002285806.1014481450PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002513884.1014481448conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A2e-3220340945252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqc_A3e-3220340945252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1cz1_A3e-3220340945252A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL450599310333420
EE076947276623370
CX664525330453740
GO266806285843680
DC8989053211284480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3Gorai.009G239600.2
Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1Gorai.003G044300.1
Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3Gorai.003G044000.2
Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)