y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G182100.2
FamilyGH89
Protein PropertiesLength: 595 Molecular Weight: 69166.9 Isoelectric Point: 5.1267
ChromosomeChromosome/Scaffold: 09 Start: 26831773 End: 26845064
Descriptionalpha-N-acetylglucosaminidase family / NAGLU family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH8912520
  MALQGVNLPLAFTGQEAIWQKVFQEKFNMSMSDLDDFFGGPAFLAWSRMGNLHGWGGPLPQSWFDKQLILQKKILARMYELGMTPVLPAFSGNVPAALKY
  IFPSAKITRLGNWFSVKNDLKWCCTYLLDATDPLFIEIGKAFIEKQLQEYGRTGHIYNCDTFDENTPPIDDPEYISSLGAATFKGMQSGDDDAVWLMQGW
  LFSYDPFWRPPQMKALLHSVPLGKLVVLDLFAEVKPIWVTSEQFYGVPYIWK
GH892535770
  VGVGMSMEGIEQNPIVYDLMSEMAFQQKKIDVKAWVDMYSTRRYGKSLPLIQEGWNVLYHTIYNCTDGAYDKNRDVIVAFPDVDPSLISVQYDQSHHYYR
  PSGTVIKEITDPFDRPHLWYSTSEVIYALELFITIGDELSRSKTYRYDLVDLTRQVLAKYANELFFKVIEAYKSHDVHGMTLLSQRFLDLVEDLDTLLAC
  HDGFLLGPWLESAKQLAQNEEQERQFEWNARTQITMWFDNTKEEASLLRDYGNKYWSGLLHDYYGPRAAIYFKYLRESLERGEDFKLIEWRREWIKLTNE
  WQKSRNTFPVESKGDALNTSRWLFN
Full Sequence
Protein Sequence     Length: 595     Download
MALQGVNLPL AFTGQEAIWQ KVFQEKFNMS MSDLDDFFGG PAFLAWSRMG NLHGWGGPLP    60
QSWFDKQLIL QKKILARMYE LGMTPVLPAF SGNVPAALKY IFPSAKITRL GNWFSVKNDL    120
KWCCTYLLDA TDPLFIEIGK AFIEKQLQEY GRTGHIYNCD TFDENTPPID DPEYISSLGA    180
ATFKGMQSGD DDAVWLMQGW LFSYDPFWRP PQMKALLHSV PLGKLVVLDL FAEVKPIWVT    240
SEQFYGVPYI WKVGVGMSME GIEQNPIVYD LMSEMAFQQK KIDVKAWVDM YSTRRYGKSL    300
PLIQEGWNVL YHTIYNCTDG AYDKNRDVIV AFPDVDPSLI SVQYDQSHHY YRPSGTVIKE    360
ITDPFDRPHL WYSTSEVIYA LELFITIGDE LSRSKTYRYD LVDLTRQVLA KYANELFFKV    420
IEAYKSHDVH GMTLLSQRFL DLVEDLDTLL ACHDGFLLGP WLESAKQLAQ NEEQERQFEW    480
NARTQITMWF DNTKEEASLL RDYGNKYWSG LLHDYYGPRA AIYFKYLRES LERGEDFKLI    540
EWRREWIKLT NEWQKSRNTF PVESKGDALN TSRWLFNKYL NLTNTETKLI EVQR*         600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12972NAGLU_C3.0e-98286579294+
pfam05089NAGLU1.0e-1391278311+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE04506.201581190808OSJNBb0059K02.16 [Oryza sativa (japonica cultivar-group)]
GenBankEEE61812.1015814901108hypothetical protein OsJ_16433 [Oryza sativa Japonica Group]
RefSeqXP_002280399.101580188805PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318632.101585191809predicted protein [Populus trichocarpa]
RefSeqXP_002511461.101585187805alpha-n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vcc_A02591298888A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vcb_A02591298888A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vca_A02591298888A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
PDB2vc9_A02591298888A Chain A, Family 89 Glycoside Hydrolase From Clostridium Perfringens In Complex With 2-Acetamido-1,2-Dideoxynojirmycin
PDB4a4a_A02591321911A Chain A, Cpgh89 (E483q, E601q), From Clostridium Perfringens, In Complex With Its Substrate Glcnac-Alpha-1,4-Galactose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7831284181625460
GW865336302563240
EE60668825112510
HO7834553211214020
HO7834551334235550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_057_00157.1Aquca_039_00072.1Aquca_057_00157.2Aquca_057_00157.3Aquca_057_00157.4
Aquca_002_00330.4.155.497Aquca_002_00330.4.155.497Aquca_002_00330.2.100.442Aquca_002_00330.2.100.442Aquca_002_00330.1.155.497
Aquca_002_00330.1.155.497Aquca_002_00330.3.100.434Aquca_002_00330.3.100.434Aquca_002_00330.1.514.887Aquca_002_00330.1.514.887
Aquca_002_00330.3.451.826Aquca_002_00330.3.451.826Aquca_002_00330.2.459.834Aquca_002_00330.2.459.834Aquca_002_00330.4.514.785
Aquca_002_00330.4.514.785
Arabidopsis lyrata488189
Arabidopsis thalianaAT5G13690.1
Brachypodium distachyonBradi1g62007.1Bradi5g24207.1
Brassica rapaBra023429
Carica papayaevm.model.supercontig_125.32evm.model.supercontig_35.39evm.model.supercontig_35.44
Capsella rubellaCarubv10000251m
Citrus clementinaCiclev10030724mCiclev10018883mCiclev10019020mCiclev10019066mCiclev10019065m
Citrus sinensisorange1.1g003545morange1.1g006843morange1.1g006829morange1.1g008173morange1.1g009062m
orange1.1g009057morange1.1g009049morange1.1g012032morange1.1g012026morange1.1g009153m.237.531
orange1.1g009153m.237.531
Cucumis sativusCucsa.128090.1Cucsa.197210.1
Eucalyptus grandisEucgr.B00338.1Eucgr.G03358.1Eucgr.G03358.2Eucgr.B00338.2
Fragaria vescamrna09491.1-v1.0-hybrid.106.845mrna29475.1-v1.0-hybrid
Glycine maxGlyma10g11720.3Glyma06g19791.1.94.437Glyma06g19791.1.94.437Glyma06g19791.1.438.763Glyma06g19791.1.438.763
Gossypium raimondiiGorai.004G170700.1Gorai.004G170700.3Gorai.004G170700.4Gorai.004G170700.2.346.780Gorai.004G170700.2.346.780
Gorai.001G078400.1.96.430Gorai.001G078400.1.96.430Gorai.004G170700.2.108.346Gorai.004G170700.2.108.346Gorai.001G078400.1.466.832
Gorai.001G078400.1.466.832
Linum usitatissimumLus10039598Lus10029494Lus10043468Lus10034116.106.408Lus10034116.106.408
Lus10034116.462.875Lus10034116.462.875
Malus domesticaMDP0000220242MDP0000138607MDP0000208532MDP0000203950MDP0000134637
Manihot esculentacassava4.1_001859mcassava4.1_003710mcassava4.1_022588mcassava4.1_012214m
Medicago truncatulaMedtr3g032980.2.357.804Medtr3g032980.2.357.804Medtr3g032980.1.357.829Medtr3g032980.1.357.829Medtr3g032980.3.95.333
Medtr3g032980.3.95.333Medtr3g032980.2.95.333Medtr3g032980.2.95.333Medtr3g032980.1.95.333Medtr3g032980.1.95.333
Medtr3g032980.3.357.529Medtr3g032980.3.357.529
Mimulus guttatusmgv1a001508mmgv1a018437m
Oryza sativaLOC_Os04g55730.1.99.440LOC_Os04g55730.1.99.440LOC_Os04g55730.1.441.772LOC_Os04g55730.1.441.772
Panicum virgatumPavirv00063217mPavirv00008468mPavirv00041670mPavirv00026596m.238.567Pavirv00026596m.238.567
Physcomitrella patensPp1s329_23V6.1
Phaseolus vulgarisPhvul.005G023300.1Phvul.005G023300.2Phvul.009G182100.1.92.435Phvul.009G182100.1.92.435Phvul.009G182100.2.253.577
Phvul.009G182100.2.253.577Phvul.009G182100.1.436.760Phvul.009G182100.1.436.760
Picea abiesMA_10437144g0010
Populus trichocarpaPotri.009G058100.1Potri.012G075900.1.100.435Potri.012G075900.1.100.435Potri.012G075900.1.436.751Potri.012G075900.1.436.751
Prunus persicappa001555mppa001642m
Ricinus communis30147.m01401129864.m001461
Setaria italicaSi034295mSi009392m.103.444Si009392m.103.444Si009392m.445.774Si009392m.445.774
Selaginella moellendorffii102402
Sorghum bicolorSb01g034960.1Sb06g030930.1
Thellungiella halophilaThhalv10012727m
Vitis viniferaGSVIVT01032165001GSVIVT01007826001.97.439GSVIVT01007826001.97.439GSVIVT01007826001.468.836GSVIVT01007826001.468.836
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)